Conserved Protein Domain Family
Raftlin

?
pfam15250: Raftlin 
Raftlin
This family of proteins plays a role in the formation and/or maintenance of lipid rafts.
Statistics
?
PSSM-Id: 317632
View PSSM: pfam15250
Aligned: 18 rows
Threshold Bit Score: 585.161
Threshold Setting Gi: 768909911
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115502568    1 MGCSLNKLEKREEKRPGNIYSTLKRPQVETKVDVTYEYCFLEFTTLTAAELPRSSATRLASLRDLPDQLLELYQQGFSLA 80
gi 163915143    1 MGCGLNKLEKLDDKRPGNIYSTLKRPHVETKIDVAYEYRYVDFTTLSQAEAPNLAAIRITSLRELPAQLRELYQQGFTVA 80
gi 410896518    1 MGCGLRKLEEPEDSSPGKIYSTLKRAQVETRTDSVYEYVLLDFSL----EGSRPTVQYVSSLSELPQALLPYYTQGYVMV 76
gi 293349793    1 MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTL---QASTNPEVIKINSVLDIVAKVEDYYLKGYVVG 77
gi 755760082    1 MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTL---QASPNPEVIKINSIPDIVTKVEDYYLKGYIVG 77
gi 1022999671   1 MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTDFAYEYVLLDFTL---EEA----------------------------V 49
gi 940712940    1 MGCGLRKLDDPEDSSPGKIFSTLKRPQVETKTEVAYEYVLLDFTL---QASPNPEVIKISSIPDIVTKVDEYYRNGYVVG 77
gi 768909911    1 MGCGLRKLEEPEDSSPGKIYSTLKRAQVETRTDSVYEYVLLDFSL---E-GSRPTVQYVSSLSELPQALLPYYTQGYVMV 76
gi 45383245     1 MGCGLNKLEKHDEKRPGNIYSTLKRPQVETKIDVSYEYRFLDFTTLNDAELPGSSAIKLSSLRDLPAQLQELYQQGFVLA 80
gi 327274905    1 MGCGLNKLEKHDEKRPGNIYSTLKRPQVETKIDIFYEYRFLEFTTLSDAELPGSSAIRLSSLRDLPAQLQELYQQGFILA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115502568   81 ALHPFVQPTRRQEKILLEHIFRAILVKKTNRS-----QKAELHDEGYTLELDYCSSLEHLADQKLIPEFIKKV------- 148
gi 163915143   81 AIHPFVQSYDGAESIPQEQVFRAVLIKKIDRN-----PTSDLNNEEYRLETELCLSPDQPADQKIIPDLVKRI------- 148
gi 410896518   77 ALHPIILSVGRTRCLPFSLLYRAILVRPRHSK-----QPTAMCHSVPVLRVEEWMLPGESLTGDTVRALIDRV------- 144
gi 293349793   78 AIHPVIQPVGQRKHLPASHLYRAVLSRVKLSSk----HSAAGGQRRARLVIEECPLTCETQGNDSAKELIDKV------- 146
gi 755760082   78 AIHPVIQPVGQRKHLPASYLYRVVLLRLKLSLk---hSAASSGQRRPRLVIEECPLTYETQTNDIAKELIEKI------- 147
gi 1022999671  50 IFSLVIQAFRVKLSVVIR----------KHLQslsqtQTTPKGQARPRLVIEECPLSYETLTNEGAKGLIEKI------- 112
gi 940712940   78 AVHPVLQPVRQRRPLPASHLYRVVLWRLKLSPk---lSAAPSGQRRPRLVIEECPLMYETQANDVAKELIEKI------- 147
gi 768909911   77 ALHPIILSVGRTRCLPFSLLYRAILVRPRHSK-----QPTAMCHSVPVLRVEEWMLPGESLTGDTVRALIDRVsgvccts 151
gi 45383245    81 AVHPFVQPTDEKEKTPQEQIFRAVLIKKTERS-----PKGGIHSEGYILEVECCSSVNQLSDKKEIPDFIKKI------- 148
gi 327274905   81 AVHPFVQPTNENEKTPQEQIFRAVLIKKTERS-----LKNDVIGDGNALEIESCFSSDHLLDKSKMPDLIKKI------- 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115502568  149 -QEAASQGLKFVSVVPQYQPSVSSAGSRRLKPVANSVE--DARDVKCTLGD---RSSLENDTPKAAETDAAT----AGVN 218
gi 163915143  149 -EDAASQGSKFAGIIQGYCTAPNLPYSPSDSLSHCSSP--LFTTAKKTFSDtedDVSVDIDKPDGTNGNASL----SAHR 221
gi 410896518  145 -NSSARGGVRFIGSVLQQAS------------GTTNSR----------RSSpkrGCRSPSGSPPGMPAKDRE------LE 195
gi 293349793  147 -NAAAKRGMRFVGFVPQHCSPSKHCNGASQ-DGVAESE-------LHKRQGsqdNCKSLND--GTL----WE----SGVE 207
gi 755760082  148 -NIAAKRGMKFVGFISQPYSPLKFCNGTNH-DEDIESA-------LPLRHTsdeNCKSWNE--GTLSGQSSE----SGIE 212
gi 1022999671 113 -NEAAKRGMKFVGFVTQHCPQSKVCNGTSP-DGDVESEssLYRIQEHQRHNsdeNCKIWNE--GTLSGQSSE----SGIE 184
gi 940712940  148 -NEASKRGRRFVGLLAQHSAP--FCNGTDL-NGDGEPA-------LPGRHScedHGRSWSE--GPLSGQPSE----SGAE 210
gi 768909911  152 vNSSARGGVRFIGSVLQQA------------SGTTNSR----------RSSpkrGCRSPSGSPPGMPAKDRE------LE 203
gi 45383245   149 -QDAASQGLKFVGIIPQYHSQKNCLVSSSLTPASNNSV--QSRDNKNVSNCpedHASLDGEKIDGINGCSTPapgeENAD 225
gi 327274905  149 -QDAASRGLRFVGIIPQYDSQMNSKSSSAITSTSSSSR--ELKGDKNPSEFpedCGSPDHDRADCTNGYSVSeareDDAE 225
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115502568  219 RRPETk-----PGStgdvpsAQQPGIpsPSAENEAGEFP------L------RglqpaLdrsegdps----ngpeelpsR 277
gi 163915143  222 ESADHskvlegEGPd----tGKEKQE--SALKDQGDQTAninfsiStedvfiQdk-itKad-----------------sG 277
gi 410896518  196 ENSHS------P-------------------------------------------------------------------- 201
gi 293349793  208 EEPQPe--------------SGQHQ-----TEGNSSLSYsnpkrgE------A--------------------------P 236
gi 755760082  213 EELHHe--------------SEQCQ-----MDRDGSPSYsksrkgE------E--------------------------- 240
gi 1022999671 185 EEIHHe--------------SGLWQ-----MGREGSPIPsksrkgE------D--------------------------- 212
gi 940712940  211 GELHPq--------------SGPCQ-----REPHGSPRSseatrgE---------------------------------- 237
gi 768909911  204 ENSHSp----------------------------------------------------D--------------------- 210
gi 45383245   226 QCATSr-----EGRkgegqaAEEPDC--KSAKGSKEQHE------H------PggreaPdtqngvaenetparcskpltD 286
gi 327274905  226 QCVDSi-----EDPggegqvTEHLSL--SSVGENGGHLQ----------------------------------------- 257
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115502568  278 KM--------EIFAFFN------RPKSQQKCRQYYPVTIPLQVSKNGQTVSSLDASWLEHMSDHFRKGGVLVNAVFQLGM 343
gi 163915143  278 IHdncniktsEVLAIFN------KPLTQQRYRKYYTVNIPMKISKDGNIVNGLEANWLEYMTDHFRKGCSLVNAVFYLGM 351
gi 410896518  202 DL--------KLLVFFHswapgcAPLDSLAC-HYHQGALSMRVSRKGHVVSALEADWLELTATYYRKGWSLVDSFVYWDT 272
gi 293349793  237 DN--------KVYMVFN------AFEEDSACWTYQEGILSMKVTRKGAVISTLDANWLELTTFYYKQGLSLVDSFVCWET 302
gi 755760082  241 -N--------KLYTIFN------VFDDESTCWTYQEGILSMKVTRKGSVISTLDADWLELTTFYYKQGLSLIDSFVCWET 305
gi 1022999671 213 -N--------KLYTVFN------VFDDESTCWTYQEGILSMKVTRKGSVISTLDADWLELTTFYYKQGLSLIDSFVSWET 277
gi 940712940  238 DN--------KLYIVFN------VFDDESTGWTYQEGILSMKVTRKGPVISTLDADWLELTTFYYKQGLSLIDSFVCWET 303
gi 768909911  211 -L--------KLLVFFHswapgcAPLDSLAC-HYHQGALSMRVSRKGHVVSALEADWLELTATYYRKGWSLVDSFVYWDT 280
gi 45383245   287 KT--------EIFTLFN------KPKTPQRCSQYYTVTIPMRISRNGQTVNSLEANWLEHMTDHFRKGGSLVNAIFSLGM 352
gi 327274905  258 EI--------EIFAAFN------KPKTSQRSAQYYSVTIPVRIISNGQSICSLEANWLEHMTDHFRKGSILVNAIFSLGI 323
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 115502568  344 AN-DSFYGLTDGVFIFEAVSTEDNRTT-QGYDAIVVEQWTVLEGTEVQTDYMPLLNSLAAYGWQLTCVLPTPILKTTREG 421
gi 163915143  352 VN-EFSSEYTDGVFIFEDYPEQDPKII-KRYDAIVVEQWTILQGLEVHTDYMPLLNSLAVYGWQLTCVISTPIVKTSRDG 429
gi 410896518  273 PKgEPVPRSLEGLFVYEERSPSPP-----ANDTIVVEQWTVIESSNMKTDYGPLLHTLAEFGWLLTCVLPTPIMRHDSDG 347
gi 293349793  303 PKgDQLPKSLEGFFIYEEEGSGVPGSNrRGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEG 382
gi 755760082  306 SKgDHLPKSLEGFFIYEEEGSGVPGSSrKGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEG 385
gi 1022999671 278 SK-DHLSKSLEGLFIYEEEGSGVPGSNrKGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEG 356
gi 940712940  304 PRgDHVPKALDGFFIYEEEGSGVPGSSrTGNDAIVVEQWTVIEGCEIKTDYAPLLHTLAEFGWLLTSVLPTPVLRHDSEG 383
gi 768909911  281 PKgEPVPRSLEGLFVYEERSPSPP-----ANDTIVVEQWTVIESSNMKTDYGPLLHTLAEFGWLLTCVLPTPIMRHDSDG 355
gi 45383245   353 VN-DSLHGTMDGVFLFEDVAVEDNKTT-QGYDAIVVEQWTVLKGVEVQTDYVPLLNSLAIYGWQLTCVLPTPIVKTNREG 430
gi 327274905  324 LN-DSFQGMADGLFIFEDLSVDDSKNI-QGYDAIVVEQWTVLEGARVQADYIPLLNSLAMYGWQLTCVLPTPVVKTNSDG 401
                         490       500       510       520       530
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 115502568  422 NVSTKQIVFLQRPCLPQK--TKKRESKFQWRFSRN-EIHGRQTRk-sKGKLSASNK 473
gi 163915143  430 NVTTKQIVFLQRPALPHK--LKKKEPKFQWRFSKD-DKHNRQSK---KGKGNSKEH 479
gi 410896518  348 NLATKQIVFLQRPVRSQA--AGKpknpvvsvhsdvsssvsralcnpvppdesslav 401
gi 293349793  383 NLATKQVVFLQRPVTWNS--AAQTPERKGGRLLRG-EDRNKVGSrsiGLDTSEcqp 435
gi 755760082  386 NLATKQVVFLQRPVMWNS--AAQTPERKASRHTKG-EDRNKVTSrsiGLDTATSQp 438
gi 1022999671 357 NLATKQVVFLQRPVMWNS--AVQTPEKKSMRQIKTrEEKSKVTSrsiGLDTATSrp 410
gi 940712940  384 NLATKQVVFLQRPALWNS--AAQTPERKASRHVKG-EDRHRVGSrsiGLDTATSPp 436
gi 768909911  356 NLATKQIVFLQRPVRSQAagKPKNP------------------VvsvHSDVSSSVS 393
gi 45383245   431 NLSTKQIVFLQRPSLPQK--AKKKESKFHWRFSKE-DMHNKPMKksrKTKLSSGEK 483
gi 327274905  402 NLSTKQIVFLQRPFLPQK--TKKKQPKFHWRFSKE-DRRRKQAKkslKARLSAREQ 454
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap