Conserved Protein Domain Family
SPATIAL

?
pfam15256: SPATIAL 
SPATIAL
SPATIAL (stromal protein associated with thymii and lymph node) proteins may be involved in spermatid differentiation.
Statistics
?
PSSM-Id: 317638
View PSSM: pfam15256
Aligned: 25 rows
Threshold Bit Score: 220.319
Threshold Setting Gi: 741929390
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 762108571  67 FFTRHNPHPSRVRHIKGLLDVPICAVNDD-------GYFASP-------KyslqfppnafnnkqmnkWKGQVPVNAINVN 132
gi 198422329  75 FFSRHNPHPVRVRHIKGLNGIPICTVNDFgrvplnrFNITTPtsrerndL-----------------FKNHLASTTLGIN 137
gi 348564551  62 FLVRHTPHPRRVCHIKGLNNIPICTVKDD-------ELVLR---------------------------------TLQGGD 101
gi 395852082  40 FLVRHTPHPRRVCHIKGLNNTPICTVNDD-------ENMLR---------------------------------ALHSGD 79
gi 395542141  27 FLVRHTPHPRRVCHIKGLNNIPICAVNDE-------SFF----------------------------------KALYDAS 65
gi 532080220  29 FLVRHTPHPRRVCHIKGLNNIPICTVNDD-------ELALG---------------------------------ALYGVS 68
gi 741929390  27 FLVRHTPHPRRVCHIKGLNNIPICNVNDD-------ENSFR---------------------------------TLWGVG 66
gi 554524890  27 YLVRHTPHPRRVCHIKGLNNIPICTVRDD-------ENS------------------------------------LWDVD 63
gi 675648425  29 FLVRHTPHPRRVCHIKGLNNIPVCTVNDD-------ENAFG---------------------------------TFWGVG 68
gi 291401384  25 FLVRHTPHPRRVCHIKGLNNIPICTVNDD-------EIALR---------------------------------TLWGVG 64
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 762108571 133 SRLHPIntvtGLQyftglnsypfR-EKAVPRVGMVP--V--TEQW--RDEL----Q---QLTKAIGFG--------TDEL 190
gi 198422329 138 STDFPIdtitGLQny------pfR-EKALPRIGLVP--I--TESW--RGEL----H---DFCTKVGLT--------FPEV 189
gi 348564551 102 QFSHL------------------D-KNDTPPSKGNYlpI--PAAP--ESPV----R---GVSPASNSFkmll-rphSEPS 150
gi 395852082  80 QLSHA------------------E-EGKIPCAKCSC--P--PSAPdsQSSG----R---GVSPTSTVIktlp-rphSEPS 128
gi 395542141  66 QLATP------------------D-KDTPAINKVAS--AnsIRSF--QYPGsnkmK---TL-PRPN----------SEPC 108
gi 532080220  69 QFDQL------------------E-KDEIPFAKCNY--PpsPAAP--ESPV----R---EVSPAQSRVkmpp-rphSEPC 117
gi 741929390  67 QSHHS------------------Q-KDEIPYARCSY--PpsAVAT--ESP----------VSPALNGVkvpp-rphSEPC 112
gi 554524890  64 QFNHL------------------EtTDNIPFAKCSH--PpsTAAL--ESPV----R---GVSPAPKSAnvhpprphSEPC 114
gi 675648425  69 QSNHL------------------E-KNRIPFAKCSY--ApgTAGQ--ESPV----R---EVSPAPNSAkvpp-rphSEPS 117
gi 291401384  65 QSNHT------------------E-KEEKPVAKYSE--PpsTTVQ--EIPG----RgvsGVSPAPNWVkvpp-rphSEPS 116
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 762108571 191 APQKPQaPGVPer----------pKTQYSETTGRIIPPPSRAMSR-GKTGSRQGRDRYFGTLQhIAPEPDMETMVLQMLC 259
gi 198422329 190 ELQ----PAVPttpa------vkrETIYSRRTGRIKPPTSRSSHRyPRPMNYNH----------ITSYPDTESLMLELLC 249
gi 348564551 151 RKVNECfKTSSdnpfviqkeefkaKKLPS-------PPKASSTAGsYSSEASLPRPDVKEKTVcIPNYLEQEIKILAKLC 223
gi 395852082 129 RKMKECfKTSNenplvikkeemkgKKLPSA-------PKTSSTAGsGSSERMTSKNDIKANTVsIPNYLDQEIKILAKLC 201
gi 395542141 109 KQTEDF-FDDPsdgv------lkiKKE--ELRGRSHLSNSKANKSlMVSEHNDSKKEMRSKTIcIPNYLDQEIKILSKLC 179
gi 532080220 118 RKFNECfKTSSenplvikkeeikvKKSPS-------PPNACYTAGsCSSEAMSTKADVKENTVcIPNYLDQEIKILAKLC 190
gi 741929390 113 RKVKECfKTSSdnplvikkdemkvKNPPL-------TPKSCSTASsSSSEVTSTKTAIKENTIcIPNYLDQEIKILEKLC 185
gi 554524890 115 RKIKECfKTSSenplvikkeeievKNPPS-------PPKACSTTGsCSSEVLSTKTNAKESTIcIPNYLDQEIKILAKLC 187
gi 675648425 118 RKIKECfKTSSenplvikkeeikaKRPPS-------PPKACSTPGsCSSGMTSSKNDVKANTIcIPNYLDQEIKILVKLC 190
gi 291401384 117 RKIKECfKTSSenplvikqeeskvTKPPS-------PPKVHSTAGsCSSEVMPTKVEVKESTVrIPNYLDQEIKILAKLC 189
                        250       260       270
                 ....*....|....*....|....*....|....
gi 762108571 260 QILQTEDINAVQAWLCSAGEREKTVVMDLIRSAV 293
gi 198422329 250 QVLHTDSIPSVQQWLVSAGDREKGLVMEIIKSAI 283
gi 348564551 224 DILHTDSLAEVLQWLLHASTKEKQWVSALVHSEL 257
gi 395852082 202 DILHTDSLGEVLQWLLHASTKEKEWVSALIHSEL 235
gi 395542141 180 EILQTDSLAELLEWLLQASVQEKEWVSALIHSEL 213
gi 532080220 191 DILHTDSLAEVTQWLLHASTKEKEWISALIHSEL 224
gi 741929390 186 NILRTDSLAEVLQWLLHASSKEKEWVSALIHAEL 219
gi 554524890 188 NILHTDSLAEVLQWLLHASSKEKEWVSALIHAEL 221
gi 675648425 191 DILQTDSLAEVLQWLLHASSKEKEWVSALIHSEL 224
gi 291401384 190 DILHTDSLAEVLQWLLHANTKEKEWVSAVIHSEL 223
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap