Conserved Protein Domain Family
FAM222A

?
pfam15258: FAM222A 
Protein family of FAM222A
This protein family, FAM222A are a domain of unknown function. This family of proteins is found in eukaryotes and are typically between 411 and 562 amino acids in length. In humans, the gene encoding this protein domain lies in the position, chromosome 12 open reading frame 34.
Statistics
?
PSSM-Id: 317640
View PSSM: pfam15258
Aligned: 10 rows
Threshold Bit Score: 665.404
Threshold Setting Gi: 908513325
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350  27 KWETTQKMRSASYPTPaELDAYAKKVANNPLTIQIFPNSVKVPQRKHIRRTVNGLDTssSSQRHSPYP-SQVSSSRGLLA 105
gi 348537401  27 KWDTTQRMRSAPFPTPaELDAYAKKVANNPLTIKIFPNSVKVPQRNHVRRTVNGLDT--SGQRYSPYPsSQASAKTGLLA 104
gi 410925880  27 KWDTTQRMRSTPFPTPaELDAYAKKVANNPLTIKIFPNSVKVPQRNHVRRTVNGLDT--SGQRYSPYPsSQAGAKPGLLA 104
gi 908513325  27 KWETTQKMRSASYPTPaELDAYAKKVANNPLTIQIFPSSVKVPQKKHIRRTVNGLDTslSNQRQSPYS-SQVGNSGGLLA 105
gi 47213569   27 KWETTQKMGSASYPTPaQLDAYAKKVANSPLTIQIFPNSIKVPQRKHLRRTVNGLDTslSAPRHSPYP-TQVSSNRGLLA 105
gi 573906368  27 KWDTTQKMRSAQYPTPaELDAYAKKVANNPLTIKIFPNSVKVPQRKHVRRTVNGLDT--SGQRYSPYP-SQASTKAGLLA 103
gi 556998252  27 KWDTTQKMRSAQYPTPaELDAYAKKVANNPLTIKIFPNSVKVPQRKHIRRTVNGLDT--AGQRYSPYP-TQASTKAGLLA 103
gi 512819984  27 KWDTTQKMRSAQHPTPaELDAYAKKVANNPLTIKIFPNSVKVPQRKHIRRTVNGLDT--SGQRYSPYP-LQVSTKTGLLA 103
gi 224076417  27 KWDTTQKMRSAQYPTPaELDAYAKKVANNPLTIKIFPNSVKVPQRKHIRRTVNGLDT--SGQRYSPYP-SQATTKTGLLA 103
gi 117306174  27 KWDTTQKMRTAHYPTPaELDAYAKKVANNPLTIKIFPNSVKVPQRKHVRRTVNGLDT--SAQRYSPYP-TQAATKAGLLA 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 106 VLRAP-AKGIIKESDGSRAQQLHKAIMNPHSGPY--TTQSTLNlpqpaphlqgpsqpaaqvaqkqgmvnpqalqqqqsmt 182
gi 348537401 105 IVKVPtVKGILKDFDGSRARLHPDVIMNPPTGPYqvASTSTLN------------------------------------- 147
gi 410925880 105 IVRAPtVKGVIKDFDGSRTRLNPEVIMNPPTGPYqtASTSTLN------------------------------------- 147
gi 908513325 106 VLRAP-----VKNSDSSHVRQLHNSVMNPHSGPY--ATESTLN------------------------------------- 141
gi 47213569  106 VLRAP-SKDGIKEPGSGRARQLQKATMNPHNGSY--AAHSTLNlpqsahn------------------------------ 152
gi 573906368 104 IVKVP-AKGILKDFDGSRARLLPEVIMNPPSGPY--ITPSTLNlpq---------------------------------- 146
gi 556998252 104 IVKPP-SKGVVKDFDGTRMRLLPEAIMNPPSTPY--VAPSTLN------------------------------------- 143
gi 512819984 104 IVKSP-AKGVLKDFDGTRARLLPESMMNPPSAPY--VAPSTLN------------------------------------- 143
gi 224076417 104 IVKSP-AKGIIKDFDGTRARLLPEAMMNPPSTPY--VAPSTLS------------------------------------- 143
gi 117306174 104 IVKVP-AKSILKDFDGTRARLLPEAIMNPPVAPYatVAPSTLA------------------------------------- 145
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 183 hpmtlqqpqtmpHPqaLq-----------qRSMAHTqal-qrQQSL---------------------------------- 216
gi 348537401 148 ------------HQ--V-------------QNLPRP------QQSL---------------------------------- 160
gi 410925880 148 ------------HRhpL-------------PGLPRL------QQS----------------------------------- 161
gi 908513325 142 ------------HPqpaphlqgpsqsalqkQNLVHPqal-qqQHRL---------------------------------- 174
gi 47213569  153 -----lrgssrpAVetPq-----------kQSMVHPqtl-qlQRSL---------------------------------- 181
gi 573906368 147 ---------tvpH---P-------------QGLPRPqgl-shQQTI---------------------------------- 166
gi 556998252 144 ------------H---P-------------QALPHPrtl-qhSQIL---------------------------------- 160
gi 512819984 144 ------------H---P-------------QGLTRPqqalqhAQALqhaqsmqqqqqtlthsqsmppglqhpstlqhpqg 195
gi 224076417 144 ------------H---P-------------QALARQqal-qhAQTL---------------------------------- 160
gi 117306174 146 ------------H---Pq-----------aQALARQqal-qhAQTL---------------------------------- 164
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 217 -----Sqv-------------------------------qtSQ----------QqRLAHPQGIQRQ------Q------- 237
gi 348537401 161 -----P-----------------------------------LP----------PqDPPQTVHIPLPqqqvhtQ------- 183
gi 410925880 162 -----------------------------------------VH----------LqDPTPTLQMPVPqqqdhtQ------- 183
gi 908513325 175 -----ThpmalqqphpqalqqrnmarsqalqqqqslsqiqaPQ----------QpRLAHAQGMQRQ------Q------- 226
gi 47213569  182 -----Sqp-------------------------------maP-------------------------------------- 187
gi 573906368 167 -----Q-----------------------------------QQ----------AqGLRHPPGMAQP------P------- 183
gi 556998252 161 -----Qqpp------------------------------slAQ----------AqTMPHPQNLPQ-------Q------- 181
gi 512819984 196 lpqglQh----------------------------------SQglqntqsipqPqTLQHTQSIPQP------Qtlhhgqg 235
gi 224076417 161 -----Phpq------------------------------siPQ---------------HPQGIPQP------P------- 177
gi 117306174 165 -----Ah----------------------------------AP----------PqTLQHPQGIPPP------Q------- 182
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 238 --------------------------------SLPH--T-------------------------QALQQqpsqscppvvp 258
gi 348537401 184 --------------------------------SLRQppP-------------------------MAQHP----------- 195
gi 410925880 184 --------------------------------SLRHhlP-------------------------MAQIS----------- 195
gi 908513325 227 --------------------------------SLPH--NqtvqqqpqqgqscssvvpqqhlshlQSLKHqpappqallsq 272
gi 47213569  188 --------------------------------AMPH--P-------------------------QALQQkg--------- 199
gi 573906368 184 --------------------------------SLQH--P----------------------------------------- 188
gi 556998252 182 --------------------------------TLQH--P-------------------------QNLPRpq--------- 193
gi 512819984 236 lpqtqrqqsipqnlqhqqtinqtlqhaqnmsqALQH--T-------------------------QGLQRpq--------- 279
gi 224076417 178 --------------------------------SLPH--P-------------------------QGIP------------ 186
gi 117306174 183 --------------------------------ALSH--P-------------------------QSLQQp---------- 193
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 259 qqhlshlqtlkhqpappqalltqqgvtqdlrhmsdgaqlPSLQHTQGLVGSQPLPQa--VGAGP---PTi--pNSL---Q 328
gi 348537401 196 ---------------------------------------QGPARLQTQSQHPALGHp--QGPPTvmlQQ----QHLqqqQ 230
gi 410925880 196 ---------------------------------------QGPPRLQ--AQHPNFSHm--QGPPTamlQQ----QHLk--Q 226
gi 908513325 273 qgv-----------------------tqdlrhisdgsqlPSMQHTQGLVGSQALPQavaAGPPT---MP----NCP---Q 319
gi 47213569  200 --------------------------------------aPHLQ---GLAASQTLAHa-aAGPPA---MT----NAL---Q 227
gi 573906368 189 ---------------------------------------PGLPPTQTLSHPPSLGHp----PPGillQQ----QPL---- 217
gi 556998252 194 --------------------------------------tQTLPHPQDMPRPQTSQHq----------QNlshgQTL---Q 222
gi 512819984 280 --------------------------------------nMGSQHSQSMPQQNSLQHa----------TGis-hQAL---P 307
gi 224076417 187 ---------------------------------------QALPHPQNMQQPQGLQHp----------QTma-hQSL---Q 213
gi 117306174 194 ---------------------------------------QGLGHPQPMAQTQGLVHp----------QAla-hQGL---Q 220
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 329 QPP-----PGAYGPRKLPDADAPPNVTVSTSTIPLSMAASLHQNRPSDLSSIVHQINQLCQARA-GMGTTSVCEGQIANP 402
gi 348537401 231 QPP-----PGLQGSRKLPDGDAPPNVTVSTSTIPLSMAAGLNQGRQADLNTIVHQINQFCQARAqGSGTTSMCEGQIANP 305
gi 410925880 227 QPP-----PGLQGSRKLPDGDAPPNVTVSTSTIPISMAAGLHQGRQTDLGTLVHQINQFCQARArGSGATSMCEGQIANP 301
gi 908513325 320 QAR-----LGPYGPQKLPDPDAPPNITVSTSTIPLSMAASLHQNRPGDLSIIVHQINQLCQARA-GMGTTSVCEGQIANP 393
gi 47213569  228 QPP-----PGTFGPRKLPDADAPPNVTVSTSTIPLSMAASLHQNRAGSLSSIVHQINQLCQARA-GMGATSVCEGQIANP 301
gi 573906368 218 -PP-----LGLHGSRKMADADAPPNVTVSTSTIPLSMAASLHQNRPADLSSIVHQINQFCQARA-GISTTSVCEGQIANP 290
gi 556998252 223 HPPnpllqPGLHGSRKVPDADAPPNVTVSTSTIPLSMAATLQQNRPPDLSSIMHQIHQFCQARA-GINTTSVCEGQIANP 301
gi 512819984 308 HPAntllqPGLHGARKMPDADAPPNVTVSTSTIPLSMAATLQQNRPPDLGSIVHQINQFCQARA-GIGTTSVCEGQIANP 386
gi 224076417 214 HPPnpllqPGLHGGRKMPDADAPPNVTVSTSTIPLSMAATLQQNQPPDLSSIVHQINQFCQARA-GISTTSVCEGQIANP 292
gi 117306174 221 HPHn----PLLHGGRKMPDSDAPPNVTVSTSTIPLSMAATLQHSQPPDLSSIVHQINQFCQTRA-GISTTSVCEGQIANP 295
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 403 SPISRNLLINASSRVSSHH--PALGSVPSCLMVGPPDKa----tAQTPSAAlHSQPNIAATNSIqvP-AFHTDQek---- 471
gi 348537401 306 SPISRNLLISACSRVSMHSnpATPGFPPPNCIIGSQEK------APAPVGA-HPPPSVAAMNHL--P-SNHTDLkqqhql 375
gi 410925880 302 SPISRNLLISACSRVSMPSqpITPGFPPTNCIIGPHEG----------LGC-QPSSSVAVMNHL--P-SVHTDVkqqhhh 367
gi 908513325 394 SPISRNLLINASSRVSSHH--PALGNIPSSLMVGPPDKa----aAQAPSVSlNSQQSIAAANSV--P-AFHTNPekvvqq 464
gi 47213569  302 SPISRNLLINASSRVSSLQ--PGLASVPGGLLMGAADHa----aAQSl----HAPPAMA----V--N-AFLPEPekvhlq 364
gi 573906368 291 SPISRNLLINASSRVSGHA----VPGPLPSCVLSSADQaataqaGAVPASV------MATVNRV--PaGYHGDVkqqqq- 357
gi 556998252 302 SPISRNLLINASTRVSTHN----VPTPMPSCVVNPVDQaa--vaAAVPPAA-SGNMPIININRL--PaGYQNDMkp---- 368
gi 512819984 387 SPISRNLLINASTRVSTHS------IPMPSCVGTSVDHsa--aaAAISSAT-SGNIPMVNMSRV--PtSYPGDLkp---- 451
gi 224076417 293 SPISRNLLINASTRVSTHN----VPTPMPSCVVNPVDHa----aAAIPPAS--VNVPMVNINRV--PpAYQNEIks---- 356
gi 117306174 296 SPISRSLLINASTRVSTHS----VPTPMPSCVVNPMEHtha-atAALPAAG-PVNLP-TGISRV--PtGYPSDLkp---- 362
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 472 ----------------------------vHlqqqqlqhhlhqqkqqqqqlqqqhlqlqqlqqqrsWAQHQLAHMQQPPEG 523
gi 348537401 376 qqhqlhphqnqqqqqlqhttqqqqqqkmcA-----------------------------------WNQHQLAHVPHIQNG 420
gi 410925880 368 lqql---------------qhntphqkmrS-----------------------------------WNQHQLVQVDNMQNG 397
gi 908513325 465 qlqhhlhqqkr--qqqqhfqqlqqlqqqrS-----------------------------------WAQHQLAHMQQPPEG 507
gi 47213569  365 qlqhq-------------ahqahqaqqqrS-----------------------------------WAQHQLDHRQQLPEG 396
gi 573906368 358 -------------------------qqqrS-----------------------------------WSQHQLAHLQHISEG 377
gi 556998252 369 ----------------------------lS-----------------------------------WYQHQLIQLDHISRD 385
gi 512819984 452 ----------------------------mG-----------------------------------WNQHQLAHLQQMCGE 468
gi 224076417 357 ----------------------------vA-----------------------------------WNQHQLAHLQQMCGD 373
gi 117306174 363 ----------------------------vT-----------------------------------WNQHQLAHLQQMCSE 379
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 524 -------AHPCKNPRMEPpsecAFPSRNLSYSHKLPnTAQSFPLKHPAEKPRPSSPV--NCPVGPMP-YINGHYM-QPPW 592
gi 348537401 421 g------SHLCKQPSRDA----TFHFKGMGYPAEVC-VGQPYSLKPPVERPTPSPPVnnNGMPGPMAhYTNSHYFqSHIW 489
gi 410925880 398 g------TLLCRQPSRDL----TFHFKGMGYPVEVC-AGQPYTLKPPIERPTPSPPVnsSCMPGPMAhYTNGPYFqSHVW 466
gi 908513325 508 -------ANPCKNPRMEPpaecAFPSRNLSYSHKLPnSAQSFPLNHPAEKPQPSSPV--KCPASSMP-YINGHYM-KPPW 576
gi 47213569  397 -------AHPCKTPRMERppesDFPPHGLAYPHKLP--AQ-FALKQRADRAQPSSPV--RCPAAPMP-YANGHYL-QPPW 462
gi 573906368 378 gp----gHHPCKHSARDLpggpGFPCKALNYPQELC-VGQPFSLKPPVDKPTPSPPV--NGMPGAMT-YTNGHYF-QPVW 448
gi 556998252 386 gsg--pkELAVKHTH-REvagqGFPSKTSNYPQEMC-MGQPFNLKPPVDKPTPSPPV--NGMQGTLP-YTNGHYF-QPMW 457
gi 512819984 469 t------GVQPGKPSQREisaqVFPGKASSYSQELC-MNQSFGLKPPIEKPTPSPPV--NGLPGPLP-YTNGHYF-QPLW 537
gi 224076417 374 aag--paGLAGKHPQ-REiagqNFPGKTSNYPQELC-MGQSFSLKPPIEKPTPSPPV--NGLQGPLP-YTNGHYF-QPLW 445
gi 117306174 380 asgtpapGLTGKHAAGRElagpGFVGKAPAYPQELC-LAQSFHLKPPLEKPTPSPPV--NGMAAPLA-YPNGHYF-QPLW 454
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 734634350 593 G-SIPATAGNNGSGPQDLPVAFQGGQAAASTdr----ipGAKYRP----GKEGPPGQPKLMQNVDFL-GGDFQMPNFQEQ 662
gi 348537401 490 NsSILPTPNSDSSGSQDIAMPFHGAGPGGCTtldcappgAPHYRLgsssSSSSSSAQTNLMQTADYL-GGDFQTPYFRDQ 568
gi 410925880 467 SsSILPTPNSDSSGSQDMAMPFHGAGPGGCAtldcgppgGPHYRPgi-sSSTSSSAQTNLMQTTDYL-GGDFQTPYFRDQ 544
gi 908513325 577 S-SVQATAGN--NGPQDLSMAFQGGQAAASRdr----ipGAKYRP----GKEGPNDQSELMQNVDFL-GGDFQMPSFQEQ 644
gi 47213569  463 S-RVPVAAGNAAPGPRDLPAAFQPEPMASATer----taGAKYRP----MKEDVH-QAKLMKSVDFL-GQDFHLGGFQEQ 531
gi 573906368 449 N-NILPTPNSDSSGSQDLAMPFHGGPPATSidc----aaGAHYRAg--aGS---SSQTSVMQTMDYL-AGDFQQPCFRDQ 517
gi 556998252 458 N-NILPTPNSDSSGSQDLAMPFHGGLPGAVpid---catGTHYRAg--aGS---SSQNNMMQTMDYL-GGDFQQSCFRDQ 527
gi 512819984 538 N-NILPTPNSDSMGSQDLAMPFHGGQSAGGsld---cagGTHYRAig-gGS---SSQNNVMQTMDYLsGGDFQQSCFRDQ 609
gi 224076417 446 N-NILPTPNSDSSGSQDLTMPFHGGQPAGAtld---cagGTHYRAg--aGP---SSQNNVMQTMDYL-SGDFQQSCFRDQ 515
gi 117306174 455 N-NILPTPNSDSSGSQDLAMPFHGGQPTGApldc-aaapGAHYRAg--tGGGPVASQNSLMQTVDYL-SGDFQQACFREQ 529
                        890       900       910
                 ....*....|....*....|....*....|...
gi 734634350 663 NMDVMEKMHRSAMGQV-QEPNNGRGVHSHHPGY 694
gi 348537401 569 NLGLMGKMHRPPLSRVgPEVGDGRTALIQHPGY 601
gi 410925880 545 NLGLMSKMQRPPLGRVgQEVGDGRTALIQHPGY 577
gi 908513325 645 NVDAMGNIHRSARSQV-QEPGSSGAVHAHRPGY 676
gi 47213569  532 RMEVMEKMHRSAMGHI-QEVSSGAGLHPHPPGY 563
gi 573906368 518 NLSMLGKMHRPSMSRA-PEPGDSRNTHIQHPGY 549
gi 556998252 528 SMGMMGKALRPTMGRA-PESTDSRNIHIQHPGy 559
gi 512819984 610 SMASIGKVQRPPMSRA-PEPADSRNIHVQHPGY 641
gi 224076417 516 SMAVLGKVHRPPMNRA-PEPTDSRNLHIQHPGY 547
gi 117306174 530 SLAMLSKAHRAPGNRA-PDPTESRSLHIQHPGY 561
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap