Conserved Protein Domain Family
MLIP

?
pfam15274: MLIP 
Muscular LMNA-interacting protein
MLIP is a Muscle-enriched A-type Lamin-interacting Protein, an innovation of amniotes, and is expressed ubiquitously and most abundantly in heart, skeletal, and smooth muscle. MLIP interacts directly and co-localizes with lamin A and C in the nuclear envelope. MLIP also co-localizes with promyelocytic leukemia (PML) bodies within the nucleus. PML, like MLIP, is only found in amniotes, suggesting that a functional link between the nuclear envelope and PML bodies may exist through MLIP.
Statistics
?
PSSM-Id: 317650
View PSSM: pfam15274
Aligned: 2 rows
Threshold Bit Score: 423.92
Threshold Setting Gi: 296439407
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439407 119 MQQSDLFKAEYVLIVDSEGEDEAASRKVE-QGPPGGIGTaa------------------vrPKSLAISSslvsdvvrpkt 179
gi 677363937  96 MQENDLFKAEFILITDSGDEDEVAAASSNvHRPSNGYGPisaqllatshvspgtgagrppgDGHVPGPA----------- 164
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439407 180 qgtdlktsshpeMLHGM-APQQKhgQQYKTKSSYKAFAAIPTNTLLLEQKALDEPAKTESVSKDNTLEPPVELYFPAQLR 258
gi 677363937 165 ------------LSHSAaDPQKQ--QQYKIKTSYKAFAAIPTNTLLMEQKALEEPTKTASVTEGTALDTHSEMCSPAQLR 230
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439407 259 QQTEELCATIDKVLQDSLSMHSSD-SPSRSPKTLLGSDTVKTPTTLPRAAGRETKYANLSSPSSTVSESQLTKPGVIRPV 337
gi 677363937 231 QQTEELCAVIDQVLQDPLTMVTRQyFPADEHGVRCWQVFYKVSTTLQRAAGRETRYANLYKSAPMVTESQLTKPGVIRPV 310
                        250       260       270
                 ....*....|....*....|....*....|....
gi 296439407 338 PVKSRILLKKeEEVYEPNPFSKYLEDNSDLFSEQ 371
gi 677363937 311 LVKGKSAQQK-EEPYQPNPFKKYLEEIGDQDTEQ 343
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap