3DVU


Conserved Protein Domain Family
Bcl-2_3

?
pfam15286: Bcl-2_3 
Click on image for an interactive view with Cn3D
Apoptosis regulator M11, B cell 2 leukaemia/lymphoma like
pfam02180. Bcl-2_3 is a small family of eukaryotic proteins associated with autophagy. The family is found in association with pfam00452.
Statistics
?
PSSM-Id: 317660
View PSSM: pfam15286
Aligned: 3 rows
Threshold Bit Score: 68.1849
Threshold Setting Gi: 9629595
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3DVU_A         9 TYWATLITAFLKTVSKVeELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRAdYGPALKNWKRDLSKLFTsLFVDVINSGR 88
gi 321496623   5 TEWRSLLKVFLLKSSGC-SCQGVSAGLLADVDVLDKLTTDFITKYESVYGK-LPLTQSDWVNNITALLF-FMLDKINFGR 81
gi 9629595     8 TYWATLITAFLKTVSKVeELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRAdYGPALKNWKRDLSKLFTsLFVDVINSGR 87
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
3DVU_A        89 IVGFFDVGRYVCEEVLC-PGSWTEDHELLNDCMtHFFIENNLMNHFP 134
gi 321496623  82 FIGLFAVGKFVCQELLLsSTTWSMAHDLLFHKL-ALVLEVKIMPWLT 127
gi 9629595    88 IVGFFDVGRYVCEEVLC-PGSWTEDHELLNDCMtHFFIENNLMNHFP 133
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap