Conserved Protein Domain Family
Treslin_N

?
pfam15292: Treslin_N 
Treslin N-terminus
This family represents the N-terminus of treslin, a checkpoint regulator which plays a role in DNA replication preinitiation complex formation.
Statistics
?
PSSM-Id: 317665
View PSSM: pfam15292
Aligned: 20 rows
Threshold Bit Score: 1074.69
Threshold Setting Gi: 768928822
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   208 FYWVDTTEWSKLWESPDHLGYWTVCELLHHGGGTVLPsESFSWDFAQAGEMLLRSGI----KLSSEPHLSPWI---SMLP 280
3_pfamImport     1 LYWVDTAESSQLIKSPDHDGYWIMLQLLQQIGGTILPsETL--CLSHHKADLADVFPr--dSGSPVPRTVPWT---TLLP 73
gi 82085445    220 LHWADSGVFKADHVAKDYTGIETLMERLGLVGGQVVPmLSPCLPLMDQHPKMNSLLAlg----------------vDAFP 283
15_pfamImport    1 LHWIDTRPHVEVMSCEDSFGFDKLSAVLAQAGGRVIP-LVALLNLCSNHNSDPGLRR-------------------ESSL 60
13_pfamImport    1 LHWIDCRSYVQVMRCEDYFGCDKLSEVLAQMDGRIIP-VVALLNLCSAQQPNSGFMR-------------------ESFA 60
5_pfamImport     1 LHWIDSRSQ---IICEDHLSLDK---ILARLGGRVIP-VVALLNLCSSQNPDASFRR-------------------ETFT 54
gi 637351216   209 LYWVDTTEPMKLLESPDCMGYRLLSDLMLLLGGTILPsENFIHYLNHQRGGTVSAVPvkfwDAEPALN--------KTLP 280
gi 972963861   223 LHWVDATVNSHVCRPADHTGCELVSEVLRQVGGSVLP-LDALLWLSEPGKSGLGGPAqswdHKRPLARGGREA---V-FP 297
gi 597760611   216 LHWADFSVYKHTNGSDDYMGLKTITEVLQQVAGKVVPvLTPTVAPKREHE-------------HPNLGITDITarlQALP 282
gi 765121885   211 LHWIDTRSYNQVVSCEDHLGSDEVAGVLSQVGGRIIP-LVALLDLCCQQKSDSRLAK----D---------------AFG 270
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   281 TDATLNRLLYNSpEYEASFPRMEGMLFLPVEaGKEIQETWTVTLEPLAMHQRHFQKPVRIFLKGSVAQWSLPTSSTLGTD 360
3_pfamImport    74 SDSALNSLFSKPsVFYSVFPQQEGTLFLSMPeGKK--ESCAVILEPLAMSQRQLHCPFNIILKGSVMNWNWMQAVSFLTE 151
gi 82085445    284 IDSTNSYLHLSKrMQQQLFPPLGASFSWIADgTK---RSCNVTLEPVSYRQRSLRAPVDVLLKGVLQSLDILSLSHSAIE 360
15_pfamImport   61 FSSSVGFLLSSErLYRLAFPASDAVLFVTN--LGNESHSCHVVLEPVCRGQHLLQESAEVYLKGALQGWDASCLTQTPTE 138
13_pfamImport   61 FKSSIGYLLSSErHYRLAFPVIGGVLQWQQ---GDVTQSCGVMLEPVTRRQKLLPESVKMSLKEVLRGWDASSLIQTSTE 137
5_pfamImport    55 FRSGIGYLLSSErQHSLAFPAIGGVLRWEQ---GDRTQSCGVTVEPVSRRQRLLPESVEVCLKGVLQDWDDSSLTQTPTE 131
gi 637351216   281 FDSSLNCLFSLPsVLQATFPPLEGVLFLRTD-EIGEVQSCAVTLEPLTLSQQCFKGPVNISLKCAVTGWNAVHIESFYAE 359
gi 972963861   298 LDSSLSCLLSSEqLYRVAFPSQTGVLQWGA---GKESKSCAVSLEPMSLRQRVLPSSVNITLHGVLSEWSAPALGGLSLE 374
gi 597760611   283 TSSTVDYILSSEkTYQWAFPAVVGNLCWGAD---EEKQMCSVSLEPVSCTQRPLCTPVTVTLRTVLEGLDTSSLRQSASE 359
gi 765121885   271 LKSSIGYLLSSEsLFQQA----RGVLRW--D-QGNIAQSCAVTVEPVLCRQRIPQEPVEVCLKALVPCCDASSVTQISTE 343
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   361 SWMLGSPEESTATQRL-LFQQLVSRLTAEELHLVADVDPGEGRPPITGVISPLSASAMILTVC--RTKEAEFQRHVLQTA 437
3_pfamImport   152 SWILKSSETECTEQNW--LHQLLRSLVMKELHMIAEVSQTISSCPCTAVLSPLSESTAVLTLFctEKTAEVQRCNLEGAV 229
gi 82085445    361 TWILQCPDAELGQEA---FQHL-KQLSTGGHAMLAEV--SEGDVVCSAVLSVLSSCTAQITVL--QPLLAQEGQLLPADL 432
15_pfamImport  139 PWLLQLSSSSDQEAAA--FLPLFTQLSALSLHMLAEV--SHSGLSCPAVFSPLSHSTALLTIL--QPIVIQHDQLLKTNI 212
13_pfamImport  138 SWVIHGSSSGDQGAAA--FQHLLMDLSTHALHVLAEV--NDNGLLCSAVLSPLSYSTALLSIL--QPVIAQSNQRLTTEV 211
5_pfamImport   132 SWVLQCSSIDDQGAAA-AFQHLLMELSSHALHMLSDV--NDSGLVCSAVFSPVSHSTALLTIL--QSEVTQHAQFPMTDI 206
gi 637351216   360 SWILRSTSSRPSCKEPsLFQQFMKYILAQGLHLVAEVYQFGASSPCTGIFSPISDSTAILSHLsaEQAPEVETFLLQTTR 439
gi 972963861   375 GWVLHDSRDPAETAAEsLFLQLLNELSSQALHMFAEVEGSDQGPPCTAVLSPLSASTGLLTVL--QPQLASAQGLVLQ-- 450
gi 597760611   360 SWVLVCPQKTEPSHAA--FHYLLNELAVQSSDMLAEV--VEGGLIRSAVLSLLSPHTALLTLL--QPLSTQSKEVLDTNL 433
gi 765121885   344 SWVLKGDQE-----AA-AFLQLLRELSSLDSNMLAEV--NVGGLVCSAVLSPLSHSTALLTVL--QPEIPQQNQLLKTNA 413
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   438 VADSPRDTASLFSDVVDSILNQTHDSLA---DTASA---ASP-VPEWAQQEL-GHTTPWSPAVVEKWFPFCNISGASSDL 509
3_pfamImport   230 VETSFQDDALHLPDVVHSVLSEIDMAVE---DSLANt-eETP-VPEWVQREL-SSTGGWHPSVLEAWYSSSNACGASSDL 303
gi 82085445    433 VSLDTTDISGDLPDVVSSVLSVMYDIMEe--DDCSDhekMPL-VPDWANQELkQQSSSRSNGMVEGWFPLSDQSGISCHL 509
15_pfamImport  213 SSPVEMETSADLPDVVNSVLGVVYDIMNqdgDGTDDeirDPP-APEWAAQEL--SHRSPTTHTLEAWFPQSDQSGVSANL 289
13_pfamImport  212 ITPASAETSADLPDIVNSVLGVVYDIMKqdgDSVNDqlkENP-IPEWAQQEF--SHSPPATNMLETWFPQSDYSGVSSHL 288
5_pfamImport   207 AV-ATAETSAQLPDIVSSVLGVVYDIMAedeD--EDavdDGQ-VPEWAQQEV--THCPLTTGVLESWFPQSDQSGVTSHL 280
gi 637351216   440 ECHVTKDDDLRVREIVSNVFNQGCDDLErnhMGSAEcqeEAS-FPEWAQQEL-SRTPCWSPAVMEGWYSLSNFCGASSHL 517
gi 972963861   451 ---GATEPSSELPDIVASVLNHVYDFVEd--RAEGCpeeEGGgVPEWAQQEL-SCSSLPAAGLVEGWFPLSDQAGVTSNL 524
gi 597760611   434 ISSETAHNSTDLPDIVSSVLNVI---MKe--DDSTEqihQHL-LPEWANQEL-QQWRNLATDLSERWFCLSDQSGISCNL 506
gi 765121885   414 EAP---QTTTDLPDVVSSVLGVVYDIMNndeDAVNDkiqDPP-VPEWAQQEI-S--HPLTTSLLETWFPLSDLSGVSSHL 486
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   510 MESFGLLQAASANKEES---SKt---EGELIHCLAELYQRKSREEStiA--HQEDSKKKRGVPRTPVRQKMNTMCRSLKM 581
3_pfamImport   304 MDSFRLLQVPCTNVKDD---ADq--sEVELSESLSELYQRKSSEIS--A--GAGNNKKRRGVPRTPVRQKMKTMSRSLQM 374
gi 82085445    510 MESMRLLHAAPEEKEKG---EEysdtQQEITSSLSEFYQSSTAGS------SGSLRSKKRGTQCTPVRQKMKTMSRSLQM 580
15_pfamImport  290 MESIRLLHAVPDEGSTD---NLfe-aQQDLVSGLSELYQESV-----------SKKGKKRGAHRTPVKQKMKTMSRSLQM 354
13_pfamImport  289 MESMRLLHAVPEEREEE---NLpa-lQQELLSGLAEIYQSSQDSE---------KRGRKCGAHRTPVKQKMKTMSRSLQM 355
5_pfamImport   281 MESMRLLDAVPEQREEV---EQsv-lQQELISGLAELYQTSRGEE--------AKRGKKRGAQRTPVKQKMKTMSRSLQM 348
gi 637351216   518 MESFRLLLADSATEEEE---ASk--pEAELTHCLSEFYQRRVSDQS--AasRQQDHRKRRKLPRTPVRQKMKTMPRSLQM 590
gi 972963861   525 VESLRLLQAVPDEVEQGaggSSt--aELELMGCLSELYQGETTEDS--A----KRKGSRGGAPPTPVRQKMKTMSRSLQM 596
gi 597760611   507 MESMRLLHAAPEEDEEK---EEd--aQRELTHSLAELYQNNRAGH------TTGPKGKKKGTQRTPVRQKMKTMSRSLQM 575
gi 765121885   487 MESFRLLSAVPEQSEEE---EAcl-lQQELIGGLSELYQASQDHV--------NKRGRKRGAHCTPVKQKMKTMSRSLQM 554
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   582 LNVARLNVKAQKLHPDGSPDVAGEKGIQKIPSGRTVDKLEDRGRTLRSskPKDFKTEEELLSYIRENYQKTVATGEIMLY 661
3_pfamImport   375 LNVARLNVKAQKFQPDGMPAVS-EKVPQKLSAKRLDEKLEGKEKALKTs--iDLKTEEELQSHLITSYQKVVAEEVLS-S 450
gi 82085445    581 LNFARLNVKAQKTQGDSGSAGS-GKGTEKGGKKSSGDRTKPG--------LLHFSSEEELLSHLGLTYQKAVENRTMSVP 651
15_pfamImport  355 LNVARLNVKAQKSQSEAEPPGA-----DRAGKRRLSDRNKPAAAS-----ALSFSSEKELLCHLKACYDKTVAETDSSLL 424
13_pfamImport  356 LNVARLNVKAQKNQAESEQVGTEGREADRTGKRRSKISETE---------LFSFKSESELLSHLKSSYEKFMAEREESVF 426
5_pfamImport   349 LNVARLNVKAQKDQAEAEQLGAEGTAPDRPGKRRSSDRNKPGEAN-----AISFASEAELLSHLKCCYEKTAAERDSSLL 423
gi 637351216   591 LNVARLNVKAQKFQPEGEPPIS-EKASQGLLSKPSEDNVNGKGRTAKS-----FRTEEEMLSYITTNYQKAAIDGE-NLL 663
gi 972963861   597 LNVAWLNVRAQQSQAEGPQAS--ERGAAKPGKRRSGERSRASHRSA------HFKTEEELLCHLKETYQKAVSEEGSSLV 668
gi 597760611   576 LNVARFNAKAQKSQPEADLSSTT-RATEKQDRRCSSERTKKG--------PTSFKSEEEMLSHLKLRYQQAVEDKSLPLR 646
gi 765121885   555 LNVARLNVKAQKNQSEEEQMATESRTVDKPEKRRTSARGKSAG---QS--FVSFNDEAELLTHLKTSYDKTVAEKDSSLL 629
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   662 ACARNMISTVKMFLKSKGTKELEVNCLNQVKSSLLKTSKSLRQNLGKKLDKEDKVRECQLQVFLRLEMCLQCPSINESTD 741
3_pfamImport   451 ACAQNMIMAIKRFLKMQDTKEKEVACVEKVRNHLLKTSKLLRQQHGS--EKETKVRECRLQVFLRLELCLQCPSLQNNAD 528
gi 82085445    652 SQVQDLLSVVKSFLKSNT----EASLLNLVQKHVLKSCQSIRQHYGNSSDDESKIRECQLQAVLRLELCKQ--TEQEDEE 725
15_pfamImport  425 TSAQQLLNAVKTFLTAES--DWEEKASLLVEQHLMKTGKSIRQLYPAADDANSKVRECQLQVMLRLELCRRVASKQS-RL 501
13_pfamImport  427 MGVQQLVSSVKAFLAAES--DWEAKTSLLVQQHLLKTSKSIRQLYGMAADVDSKVRECQLQVVLRLELCRLFSTEQSDSL 504
5_pfamImport   424 AGVRQLMFAVKTFLGTES--DLQIKSSLLVQQHLLKSSKYIRQLYGAAADIDIKVKECKLQALLRLELCRLFPTGQSDSL 501
gi 637351216   664 THAQDMVATVNIFQKLN-----EAAFLDTVKSSLLKTSKALRQQLGSDPDQEAKIKECQLQVYLRLEMCRQCPSLQNNID 738
gi 972963861   669 TQVQNLLTLIKSFLKPTG-QDSEANCTQFVQKNLLKSSKTIREQYGNTQDIEAKIRECQMQVLLRLEMCKQFPTLLSDSV 747
gi 597760611   647 TQVQDVFSMVKTFTKKHT--DAEALFLDLVKKNILKSAQSIRQLYGSTPDTESKIRDCQLQVVVRLEICRH-PSSDQDSD 723
gi 765121885   630 KVVQQLVTAVKAFLEAKLT--GQGQTSLFIQNHLLKTSKSIRQLYGADADTDSKVRECQLQVMLRLELCSMLASEPSDSL 707
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   742 dMEQVVEEVTDLLRMVCLTEDSAYLAEFL-EEILRLYIDSIPKTLGNLYNSLGFVIPQKLAGVLPTDFFSDDSMTQENKS 820
3_pfamImport   529 eMEQLLEEMTDMLRILCLTEDPGYLTKFL-EEILELYMNSIPKTLGDLYYSLGTQIPPKLASVLPSDFFSDDSMTVDSKS 607
gi 82085445    726 vVEQRVEDVADMLRNISRSKDAVYLSRFMqEEVLPLYMNSIPKVLADVYHSLGTQLPEALVAVLPSDFFSDESLAKDSVS 805
15_pfamImport  502 dADRMAEEAAEMLRIISLTKDPACLARFLqDKVLPGFLTAVPKVLADVYNSLGTQLPDALVAVLPADFFSDDSVAKDSIS 581
13_pfamImport  505 dVDQMAEEVAEMLRIISLTRDPVFLTRFLqDEVLPGFLTAIPRVLAEIYHSLGTQLPEVLLAVLPPDFFSDDSVAKDSIS 584
5_pfamImport   502 dVDQMAEEVAEMLRIISLTKDPVCLAMFLgDEVLPGFLTAVPRVLADIYHSLGTQLPEALVAVLPSDFFSDESVAKDSVS 581
gi 637351216   739 gMDQLVEELTEMLRILCLTKDPGYLTRFL-EEVVDVYMETMPKILGDLYYSLGTQIPAKLASVLPADFFSDDSMSQDSQA 817
gi 972963861   748 rLEQLVEEVTDVLRILSLTKDPAYLTKFLeDEVLAVYMSSIPGVLGDMYYSLGTQLPERLMAVLPTDFFSDESMAQESIS 827
gi 597760611   724 dVEQMVEEVAGMLRIISLTNDPVYLSKFMqEEILPLYLKEIPKILADIYNSLGTQVPEVLAAVLPSDFFSDDSMAKESVS 803
gi 765121885   708 dSDQMTEEAAEMLRVISLTKDPVFLSRFLlDEVIPGYLNSVPRDLANIYHNLGTQLPEALMAVLPADFFSDESINKDSIS 787
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   821 PLLSVPFLSSARRSVSg----SpesDELQELRTRSAKKRRKNALIRHKSIAEVSQNLRQIEIPKVSKRATKK-----ENS 891
3_pfamImport   608 PGLPLSLSSVLTPTAVc---lQsesDQLEELRTRSAQKRRNNVLARHRSMTEASQNLRQIEIPKIDKNPIRK-----ESS 679
gi 82085445    806 VSLSSFS-ATQSNISSv----G---DHLEELRNRSAKKRRQSMITRHKSMTEAPQALRQIEMPRKSTRLAKP-----KLC 872
15_pfamImport  582 PSASSHAVSAQSLVSD---------DGLHDLRNRSANKRRSGMLTRHRSMTESTQSLRQIQLPKKTTRAKYSnlrnnKHK 652
13_pfamImport  585 PSASSLSLSAQCLVSDd----K---DGLQDLRNRSGNKRRSGMLTRHRSMTESSQSLRQIEIPKKATRASKS-----KGR 652
5_pfamImport   582 PSASSGPLSTLSMLSDg----S---GRLQDLRNRSAGQRRSGMLTRHRSMTESSQSLRQIEIPKKTTRASKS-----KGS 649
gi 637351216   818 PSVHPSASSVPVSSIVslsteA---EQLEELRTRSAKK-RKNTLARHRSVTETSQNLRQIEIPQVPKHRARK-----DNS 888
gi 972963861   828 PATSQ-LSGVPSSASNg----A---GQLEDLRNRLAKKKRSGVLTRTQSMSDASQSFRQIEMPRKSMRRESS-----KSC 894
gi 597760611   804 VG--STHSATQSVVSSv----G---NRLEELRNRSAKKRRTSVLSRHKSMTEASQALRQIEMPRKSTRQSKS-----KNS 869
gi 765121885   788 PSVSSSNMSASNLASNg----N---DGLQDLRDRTVNRKRSGMLTRHRSMTESSQSFRQVEIPKKTSKAPKP------GR 854
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156631024   892 HPAP-----QQPSqPVKDTVQEVTKVRRNLFNQELLSPSKRS--LkrgLPRSHSVSAVDGLEDKLDNFKKN-K-GYHKLL 962
3_pfamImport   680 RSYLateksQQMP-LQKEAVQEVTKVRRNLFNEGIRSPSKRT--Tk-kMPRSQSVSAVEGLRYKCTDEGAK---GHHKLL 752
gi 82085445    873 VPIEkt-avEQPP-LPKQPVQEVTKVRRNLFNQVTVSPSKKS--K---MPRSQSVSAVEGIKKRKRSDVDN-D-DRHTLL 943
15_pfamImport  653 VCAEklkyrCRDQ-TRLEDAKKVTKVRRNLFNQKIVSPSTKR--R---LPRSQSVSAVEGLKRKRPLESEG-NlEKHKLL 725
13_pfamImport  653 VSLDkpveePHPP---KQETQEVTKVRRNLFNQEIVSPSKKA--K---LQRSRSVSAVEGVKRKRSHEPE----ERHRLL 720
5_pfamImport   650 VDLEkp-gePQPK-PQKQETQEVTKVRRNLFNEEVVSTAKKA--K---LPRSQSVSALEGLKRKRIPESE----EGHKLL 718
gi 637351216   889 YACLdv-ksA-PA-PQKAAGQEVTKVRRTLFNENILSPGKRSlaK---MSRSRSVSALEGLKHKRSHSKESpR-ENQTLL 961
gi 972963861   895 VSVEqi-cqAQPP-PPKEVVQEVTKVRRNLFNQETLSPTKRA--R---MPRSQSVSAVEGSRNKRSKEMVL---DNRTLL 964
gi 597760611   870 PALEkk-vvASEP-PQKQ-VQEVTKVRRNLFNQETVSPSKKA--K---MPRSQSVSALEGMKKRKRSQIDE---DQNPLL 938
gi 765121885   855 VASEkp-pvE----AQKQETKEVTKVRRNLFNQEDVTQPKKS--K---LSRSQSVSVVEGLKRKRPDDTE----ERHKLL 920
                          810       820       830       840
                   ....*....|....*....|....*....|....*....|....*...
gi 156631024   963 TKSVAETPVHKQISKRLLHRQIKG------RSSDPGPDIGVVEESPEK 1004
3_pfamImport   753 TKRVAETPLHKQVSRRLLHKQIKG------RSSDPGCETGVVEESPEK 794
gi 82085445    944 TKKVSETPLHKQVSSRLLHRQRTG------RKSGES-DVCIIEESPIK 984
15_pfamImport  726 TKKVCETPLHKQVSSRLLGRLKAG------RKSDHK-GECIVEESPVK 766
13_pfamImport  721 TKKVCETPLHKQVSSRLLHRQKIGryvsvnRKPVLT-EECIVEESPVK 767
5_pfamImport   719 TRKVCETPHHKQVSSRLLHRQKRG------RSSVPT-EECIVEESPVK 759
gi 637351216   962 TKTVPETPLHKQISRRQLYKQIKG------RCSDPGPDVGIVEESPEK 1003
gi 972963861   965 TKKVTETPLHKQVSNRLLHRQMKG------RKLDTA-DVCIVEESPVK 1005
gi 597760611   939 TKKVSETPLHKQVSNRLLHRQKIG------RTSGQT-DMCIIEESPVK 979
gi 765121885   921 TKKVCDTPVHKQVSSRLLHRQKIG------RRSDLSED-FIVEESPVK 961
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap