Conserved Protein Domain Family
Leu_zip

?
pfam15294: Leu_zip 
Leucine zipper
This family includes Leucine zipper transcription factor-like protein 1 (LZTFL1) and Leucine zipper protein 2 (LUZP2).
Statistics
?
PSSM-Id: 317667
View PSSM: pfam15294
Aligned: 13 rows
Threshold Bit Score: 364.02
Threshold Setting Gi: 195999216
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195999216  21 FAKFKRSQQLRAVDACVNDLKDSRLNEDTYTNDEVSEIMDELRSVLKGDVETELLNVSHTNALLLQQLFHQAEKWHLKLQ 100
gi 260814904  20 FARYKRSQCLKSVDLCFEDLKDSRLTDDTFTLDEVVQMMDGLETVVRSEVESELINTAHTNVLLLWQLFSQAEKWHLKLQ 99
gi 780011621  21 FGSYKRTQNLRSVEVCFQDLKDSRLTDDTFTVDEVTDMLDGLEAVVRGEVESELINTSHTNVLLLRQLFQQAEKWHLKLQ 100
gi 198430226  20 FCRYKRNQRLKAVDHCFQDLKDSRLYEDTYTTDEVTEMLDGLLSVVRGEMEAELLNASHTSVLQLRQILSQAEKWHLKLC 99
gi 405970178  26 FSRYQRGQRLRAVEMCFEELKSSRLDETTYTIDEVTEMLDGLLSVVRGEVEGELDNTAYTNVLLLRQMFQQAEKWHLKLQ 105
gi 675879335  19 FSKYQKGLRLKSVDASFSDMESSRLQEDTYTIDEVKEIIECLNTLVRADVETELIHTSHTVVLMLVQLFQQAEKWHLKLQ 98
gi 156397324  18 FARFNRGQRIRSVEACFEDLKDSRLVEDTYTLDEITEMLDGLCAVVRGEVESELINTSHTNVLLLRQLFSQAEKWHLKLQ 97
gi 327282145  20 FARSKRGLCLKTVDSCFQDLKESRLVEDTFTIDEVTDILDGLQTVVHSEVESELINTAYTNVLLLRQIFFQAEKWYLKLQ 99
gi 483516645  20 FARFKRGLCLKTVDSCFQDLKDSRLVEETFTVDEVTDMLDGLQTVVHSEVESELINTTYTNVLLLRQLFAQAEKWYLKLQ 99
gi 441610559  82 FARSKRGLRLKTVDSCFQDLKESRLVEETFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQ 161
gi 973132443   3 FARSRRALRLKTIDSCFQDLKDSRLVEETFTVDEVSEMLHGLQVVVHGEVETELINTAHTNVLLLRQLFSQAEKFYLKLQ 82
gi 551494040  20 FARSKRLLRLKTIDSCFEELKDSrLVEDTFTVDEVREMLDGLQMVVRGEVEMELINTAHTNVLLLRQIFSQAEKFYLRLQ 99
gi 62860002   36 FARSRRALRLKTVDSCFQDLKDSRLVEETFTVDEVAEMLQGLQAVVHGEVELELINSAHTNFLLLRQLFMQAEKWYLKLH 115
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195999216 101 ADISQLENRE-LLEEIARFEEEEAASNmskqGMSG--SLSGKTSK----LQPLNEGGGAALLHMEISRLKEENETLRGRF 173
gi 260814904 100 ADISDLENRE-LLEQIMELEEREFAGKa--aNTKP--SFDSKASK----LQPLNEGGGAALLHMEIERLKEENEKLRERM 170
gi 780011621 101 ADISELENRE-LIEMIAKFEESNFSGS----AATS--KPTFELKR----LDPM-EAGGVQLLQNEIERLNEENNKLKDRL 168
gi 198430226 100 SDISELENRE-LLEQIADFEEQELSLS----GSSD--FKPL--PK----LEPLNESGGVALLQMEIERLKEENERLNERS 166
gi 405970178 106 ADISELENRE-LIETIADFEEREFAGT----TRDTdfNSVLRKMK----LAPINESGGAALLHMKIEELEKENLKLSEQR 176
gi 675879335  99 PDISELENRQyLLEKIKQFEEKTSRGD----G------EPKPAAR----LEPMNESGTSALLKMEIEKLNELNSKLKEKL 164
gi 156397324  98 ADISELENRE-LIEEIAKFEEREFTAS----SKSQ--VFEQNRMKhhliLEPLNEGGAVPLLQTEINRLNDENTKLKGRL 170
gi 327282145 100 TDISELENRN-LLEQVAEFEKSEFTSS----NKKP--NPELVKPK----LTPLHD-GASELLQKEIARLQEENEKLRSRL 167
gi 483516645 100 TDISELENRE-LLEQVAEFEKSEFTSS----NKKP--SADLIKPK----LAPINEG-GSELLNKAVACLQEENEKLKTRL 167
gi 441610559 162 TDISELENRD-LLEQVAEFEKAEITSS----NKKP--ILDVTKPK----LAPLNEGGTAELLNKEILRLQEENEKLKSRL 230
gi 973132443  83 TDVSELENRE-LLEQVAEFEKAEFTSS----SKKT--NQESNKPK----LAPLNEGGVSELLNKEIARLQEENEKLKARL 151
gi 551494040 100 SDISELENRE-LLEQVAEFEKTDFKI-----TNKI--NQETSKPK----LAPLNEGGVSELLNKEIAKLQEENDKLKSRL 167
gi 62860002  116 TDISELENRE-LLEQVAEFEKAEFSSS----NKKA--NTEMIKPK----LAPLFESGPSELLNKEISRLQEENDKLKARL 184
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 195999216 174 KMLEAKATDAIREKEMLKKSLAETQKQLEATiddiKSGKA-SVQIIKDMEKKMAEMKINLD----ENSSQLEKDNAAVMG 248
gi 260814904 171 KSVEERATGVLKDKSRLENELSETQDALGQA----KTRKSdNSGDFSDLEAQMAKVKMEMS----QGLDAKTMEAKSLEG 242
gi 780011621 169 KQVESQATGALQDRSKLETDLRRTQDELGSE----RNKQPiVSADLGDVEGKMSALKSQME----QNMKLTTDRANTMEG 240
gi 198430226 167 RSFEKHATKCVEDNKAMQKQIKEL----GAK----PVAAV-DNSSVSELETKLKAMTADFS----ESMDSKSALNEALAA 233
gi 405970178 177 IQLEKQVKS-------LGGSVAVSAAASSVA----GGSNQ-NDGEVNDLRKKLASLESDLD----STKRSSANSSNSMEK 240
gi 675879335 165 KFMEDQAIQSKKDNSQLKSDLEDAIHAMIAK----KDQK---NIYTSKMETHFNEFFVKFTqlvvQKSQMTSNQVSEMQS 237
gi 156397324 171 KDLESRATGVLGEKSQLLASLEKTQAELKAK----GNVKA-HGKELAQLEEQMAKVKLELK----KSQENTSNIAASLDV 241
gi 327282145 168 KTIEVQATSALDEKSKLEKALRELEIIQGDQ----KLNPT---QDLCELESNMADLKYKLE----KTLHDSTASQKTLEE 236
gi 483516645 168 RTIETQATAALDEKSKLEKSLKDLQMIQGDQ----Kt---nVNKDITELENRVAALKCQLE----KTLNDSTANQKSLEE 236
gi 441610559 231 KTVEIQATNALDEKSKLEKALQDLQLDQGNQ----KDFIK--AQDLSNLENTVAALKSEFQ----KTLNDKTENQKSLEE 300
gi 973132443 152 RTIETQATSALDEKSKLEKALKDLQKIQGDE----KLVLK--TKEITNLEETVAALKTDFQ----KTLNASTATQKDLED 221
gi 551494040 168 RTLETQAMSALDEKTKAERALKDLQRTQGEQ----KLSAQ--TKEINSLEDTVAALKEDYE----RSLSANAASQKDLKE 237
gi 62860002  185 KTIEYQATSALGDKIKAESALKDLQKVQDNQ----KAKQ--NTQDINILEKTMADLKCDFE----KTVNDHTVSQKYLED 254
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 195999216 249 DLTESKHQLLALQAELEQTKSELEKKFGETSQYNNMKKMLTNKNNQIKELRSRLRK 304
gi 260814904 243 DLISTKHKLLEVQEHLELAEKELDKKFQETGAYKNMKKMLTQKNDQIKDLRRRLRQ 298
gi 780011621 241 DLISSKHRLLEVQEQLEMKEKELEKKFSQTGAYKNLKSMLSKKNDQIKDLRGRLKK 296
gi 198430226 234 DLTSTKHDLLKVQEQLEMAEKDLEKKFRETGAFRNLRDMLAKKNEQLKELRKKLGK 289
gi 405970178 241 DLVSTKHELLKIKEMLEMAEKELEKKVSQTNPFKNLKQMLVKKNDQLKELRKRLSK 296
gi 675879335 238 DLAKTKHQLLEVNEMLEMAEKELEKKVSQTTPFKNLKTMVQKKNEQIKELRKKLSK 293
gi 156397324 242 DIADAKHEILRLREELEQAQQELTKKFNETSQYKNMKQMLTSKNDQIKDLRSRLRK 297
gi 327282145 237 NLISTKHDLLKVQDQLAMAEKELEKKFQQTAAYRNMKEILSKKNDQIKELRKKLSK 292
gi 483516645 237 NLVTTKHDLLKLQDQLSTAEKELEKKFQQTAAYRNMKEILTKKNEQIKDLRRRLSK 292
gi 441610559 301 NLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQ 356
gi 973132443 222 NLVTTKHDLLKVQEQLAMAEKELEKKFQQTAAYRNMKEILTKKNEQIKEIRKRLSK 277
gi 551494040 238 NLITAKHELLRVQEQLTLAEKELEKKFQQTAAYRNMKEILTKKNEQIKEIRKRLQK 293
gi 62860002  255 NLASTKHELLRVQEQLSSAEKELEKKFQQTAVYRNMKDILTKKNDQIKDLRKRLQK 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap