Conserved Protein Domain Family
Codanin-1_C

?
pfam15296: Codanin-1_C 
Codanin-1 C-terminus
This domain is found near to the C-terminus of codanin-1.
Statistics
?
PSSM-Id: 317669
View PSSM: pfam15296
Aligned: 26 rows
Threshold Bit Score: 81.9932
Threshold Setting Gi: 552809209
Created: 15-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121992980   771 ETSHVPQMEELLPVACPYLHEFRVNITPSRQSQSTGRSGrfryittRleqlnqsgattsatAQSVVACV------ELSPA 844
gi 156539949  1085 LDKLEMVDDRILYSCCPFLRELNILLTPGNSNVSNSASY-------R--------------HVTPVTSQlqk-ptKKTNT 1142
gi 751206240   389 LDKLDIITDRIMRMCCPRMESTISVF---HGNGTNL-NIns----nK--------------HITPVTSQlrk-lgSTTRA 445
gi 642925330   649 IDQLEIVDQDILYFCCPYLNEI-----KKLLTTTTTNQMit----iK--------------HITPVTAQqs---pDEIAR 702
gi 780188329   878 LDPLPLVDRLVLYTCCPFLGDLRGLL-SEASMGVNNRNAp-----vK--------------KITPVAVDapq-taI-ITQ 935
gi 37182058     48 LDNAPVVDQQLLYTCCPYIGELRKLL-ASWVSGSSGRSgg----fmR--------------KITPTTTTslg-aqPSQTS 107
gi 700358654     1 -DSVPLVDQQLLYTCCPYLGELRKLL-ASFVAGSGVKNgg----fiR--------------KITPTAAEsla-pkASVTQ 59
gi 528506728   845 LDTLPLVDQQLLYTCCPYLGEFRKLL-AAFVAGSTSKSgg----liR--------------KITPTSAEprg-psTTRSQ 904
gi 765157266   852 LDCSPLVDQQLLYICCPFLSEFRKLL-AAFVSGSTAKSgg----iiR--------------KITPTSAElkdtppANRSQ 912
gi 1035616789  379 LDKLDIINERTLRICCPLVGLNVSVS----NSNANLNNyn----snK--------------HITPVSSQlhk-saKSAGI 435
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 121992980   845 EQQQRKLGDAFLHSQNASTRRLIEFVTERSFKCVVKDAQQQILLPSKAAADGRVN 899
gi 156539949  1143 KHLEIQLEEAFFHGQPMSTRKTVEYVSERIASSSVKYICNNLLPIERQVIFQELR 1197
gi 751206240   446 KHLELQLEEAFFHGQPASTRKTVDFVSERVASTCVKHICNTLLASSREANLNSFR 500
gi 642925330   703 KKLEQQLEEAFFNGQPISLRKSVEFVSERVASTCVKYVCSVLVPEFKKKSLETFK 757
gi 780188329   936 HQIQVELEKNFFHIHSASLKKSVEFVSGRVASNCIKSIDGSLVSAARLQIPKLLT 990
gi 37182058    108 QGLQAQLAQAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVRQAESLLQ 162
gi 700358654    60 RKLQVELAQAFFHNQPPSLRRTVEFVAERVGSNCVKHIKATLVAELVQRAEVMLQ 114
gi 528506728   905 QKLQVDLEQAFFHNQPPSLRRTVEFVAERVGSNCVKHIKATLVLELVRGGEKTLR 959
gi 765157266   913 QKLQGELEQAFFHNQPPSLRRTVEFVAERVGSNAVKHMKATLVSELMERGETIFR 967
gi 1035616789  436 KHLELKLEEAFFGGQPASTRKTVDFVSERVASTCVKHICNTLLMSSREMNLNIFR 490
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap