Conserved Protein Domain Family
AKAP2_C

?
pfam15304: AKAP2_C 
A-kinase anchor protein 2 C-terminus
This family includes the C-terminus of A-kinase anchor protein 2 (AKAP2). It includes the site where the regulatory subunits (RII) of protein kinase AII binds.
Statistics
?
PSSM-Id: 317677
View PSSM: pfam15304
Aligned: 16 rows
Threshold Bit Score: 91.9049
Threshold Setting Gi: 157820703
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122139240 341 IPARLLLSKVSLA-AAP-RRDRGR-PSLYVQRDIAQESQREEDHRREGlqvgrastpdwssegpqprlrrvhssdsilsP 417
gi 301615952 311 ILKNPVVPFNSNVpSQKkSKDRAR-TSIFLQREIEKEAQREADLKNEG-------------------------------K 358
gi 971436302 381 IQTKPLLSLHTAPaQGRkGKDKGR-ASFNVQREIEKETKREEDLRRQG-------------------------------R 428
gi 242016587 187 FKIPKNLNKKDAV-ENDtRDVQHRiATNRIQQEIEEANERENELRTEG-------------------------------- 233
gi 351711529  37 LRVRPLLHLPGPSpALPrAVERAR-AGAQMQREIEREAHREAALLHL--------------------------------T 83
gi 395513391 523 ltmssrweqgvttpppssrkvswreeqvkeqpwqsqtptwreeqvreqswksqtptwreeqvreqswksqtptwreeqfr 602
gi 157820703  37 LRVRPVLSRPGSGiPLPrALERAR-AGAKMQRDIEREAHRQAALASP--------------------------------A 83
gi 513022546  37 LRVRPLLHLPGPSpALPrAVERAR-AGAQMQREIEREAHREAALLHL--------------------------------T 83
gi 513009289 293 ILTRPLLTKVNLA-EVP-RRDRGR-PSLYVQRDMVQETQRVEDHRRKGlqasgastpdwvsedpqpafgrktnsdpildP 369
gi 354480824 289 IPSRPLLNKVSLT-ELPsRRERGR-PSLYVQRDMVQETQREEDHRREGlqvgraatpdwtsqdp--qpglqrslssdcil 364
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122139240 418 TPDAHAASLAPEVRKVSRIPPDAYQPYLSP--GTPPGESPASH-AYCRPSNLSADEARP-----VGSP-----KAAGSQR 484
gi 301615952 359 VAGLYDKGSAQEIDERRKLFEQPDDISVKPqyATTKTIFKGTInSYSTGDDITQVDFGEpneknNDNS-----QDSQLPY 433
gi 971436302 429 LPGLYDRGTPQELGELRRVFEQEEQQPSSN--RRAAERPRSPGdGLNDGTRTGRALSSP-----TATPphqrgRDELWPY 501
gi 242016587 234 ------KILTTSEERVTRFTQLAEFAILEN---------------RHKDSRMKRSLSVS-----TLQV-----SDEGNNK 282
gi 351711529  84 GSEPCVRQPPPPLGELRRFFEAAAG-----------------------GDSAGND---------------------AGQQ 119
gi 395513391 603 eqswksqtpswreeqfreqswksqtpswreeqvreqpwqsqtptwreeqirekpwksqtstwreeqvreqpwksqtsttq 682
gi 157820703  84 VPEPSARPRPQPLDELKRFFEAA----------------------AEDGAS---------------------------LQ 114
gi 513022546  84 GSEPCVRQPPPPLGELRRFFEAAAG-----------------GdSAGNDTG---------------------------QQ 119
gi 513009289 370 MPDAGAADPAPETRKVNRIPPDAYQPYLGR--GTPQPEFSPCW-GYRKPSGppa-----------------spKSTRSQR 429
gi 354480824 365 sPDARATDPAPETRKVNRIPPDAYQPYLGP--GTPKLEFSAFG-VYSKPNGVSTEdtka----------mefqKAAGSPR 431
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122139240 485 HPSESSAKPSGL----KQE----PPR---GPLHASRGVLRQEYFHLRPLRFRV-----PDEPERAEATRVWGWEVA---- 544
gi 301615952 434 SVRTNWKPTPMNtyryRRQslenILD---SKPSSESSILHKENAHVKPLESHLsv--kEDEDEDEKRKQLFDRKTAnp-e 507
gi 971436302 502 ERASAGTRARED----STGgr-lPGP---TPSP----VLRREHFALSFWQPRIsv--sDGMGTRSAAGRELSPDGEhgrd 567
gi 242016587 283 NKINSAIKTPSS----SSSssllSNRrryAPNPAQKGIMQRFIATKGKIPFGSvnsesHIMGNDKNIRRGPIGRSItgid 358
gi 351711529 120 RLPEAEARGRSG----VQVrcpvLGR---APPPL---------------------------------------------- 146
gi 395513391 683 rqepwrSPPQKI----TQKawdaQER---VAGDASRGVVLRDYFHLRPMKLKFtfipgPEKVSAPKQERVWQPKISvkee 755
gi 157820703 115 RQPEAGGRLHPA----LQDgcpvLGQ---LPPL----------------------------------------------- 140
gi 513022546 120 RLPEAEARGRSG----VQVrcpvLGR---APPP----------------------------------------------- 145
gi 513009289 430 LLSESSGKPLST----K------FPL---GDLQASQTMVPREYFRLRPLQFRV-----PDVQHQAETPHVWGWEVA---- 487
gi 354480824 432 HVSEYSGSSPSS----KQArs-kPPE---KPQHGSVGIVQLENFHLRPLRFSV-----PDVPQQAETSHTWGWEEA---- 494
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122139240 545 GAPALRLQKSQSSELLEREVENVLRREREMAEERRSALYPEVFSD---EC----------------------CDHD---- 595
gi 301615952 508 AIYSVNRLRPSLSNIIEQEIKQTLERDRELKEQRRRSEVASITSP---VDiqtpvpvngytqyerpiltsgfSNQW---- 580
gi 971436302 568 EQYTLRTWRPQRSALIEEEIRSDLQREEELQEQRRRRLMDGGDGT---SR----------------------ESSR---- 618
gi 242016587 359 SSALIRKGYVPAGEKIQEELKEMEKREEELRLQRAH----NPVGP---AS----------------------FFHR---- 405
gi 351711529 147 -----------ALSLLEQEVRQVREREQELQRQRC-----SVYGT----T----------------------EFKE---- 180
gi 395513391 756 ATIHTKPLRSQSSSLLEMEIQNVLQRERELEEERRNALFPEVFSPteeMEq---------------------TFEWedsh 814
gi 157820703 141 ----------VAPSLLEQEVLRVRERERELQLQRR-----SIYGAa--------------------------eDRE---- 175
gi 513022546 146 ----------LALSLLEQEVRQVREREQELQRQRC-----SVYGTt--------------------------eFKE---- 180
gi 513009289 488 GAPALRLKRSQSSDLLEREVEDVLRREREVEEQRRSAFFPEVFSPtpeDEg---------------------CKQD---- 542
gi 354480824 495 GGPVLKLHRSQSSDLLEREMENVLRREREVAEERRNAFFPEVFSPv-qDQd----------------------EQD---- 547
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122139240 596 SRSS-SRKSSITGSYSVSES--HY--------------FTPIHLH---Sdl-vwTVEAPAKDALQQKKKKEQWYAGINPL 654
gi 301615952 581 SPAP-HRANPGTPSYILSEE--QT--------------YKLKRYP---K-----FVATESDSDQLRKYGEDSWYAGIDPT 635
gi 971436302 619 SRHS-SAASGASGSYSVSGS--PVstpqkpgvlglvtsFTPLRLScseSsg-pdSVRCSPSEERRRTTKEEGKYAGIEPI 694
gi 242016587 406 SQPNlLNISDEEGGDDDDDGelHS--------------WTSHKQH---K----------KPSLRLSHSVSNPNLLDDDCL 458
gi 351711529 181 PAPS-LTASRGDGKLAV------T--------------WPPRRKA---PdsgleQVGDPThttpscrfttvpavlgrgvg 236
gi 395513391 815 SRHS-SVASGITGSYSLSES--PT--------------FSPVCFH---Snl-vwKVTDQSPGQDKSWKKRDVGYAGLDTS 873
gi 157820703 176 PAPS-LTQSRGDGKLAVT--------------------WPPRRQA---S------------------------------- 200
gi 513022546 181 PAPS-LTASRGDGKLAVT--------------------WPPRRKA---P------------------------------- 205
gi 513009289 543 SRSS-SRASGITGSYSVSES--SI--------------FTPIHLH---Sgl-vwTVEDPTDGAS-GHRKKGQWYAGINPS 600
gi 354480824 548 SRSS-SRASGITGSYSVSES--PL--------------FTPIQLH---Sgl-vwKVQAPNDGASGQRTKRETRYAGIKPS 606
                        410       420       430
                 ....*....|....*....|....*....|
gi 122139240 655 DDVNSEILEATRVTRHRNAMAERWEAGIYA 684
gi 301615952 636 DDVNTEIVESTRVNRHKNRMAMRWEAGLYA 665
gi 971436302 695 DRINTEVVESTRVVRHQSAMGQRWESGQLS 724
gi 242016587 459 ERVN------IRMPNKRFSLLQQWEDRIQS 482
gi 351711529 237 rsapsrplkphygqnsksgaqrgrecvgvc 266
gi 395513391 874 DTVDLEIMEATRVTRHKNYLAARWEAGMYA 903
gi 157820703 201 ------------------------ENGLEK 206
gi 513022546 206 ------------------------DSGLEQ 211
gi 513009289 601 DGINLEILGATRVTHHKNAMARRWEAGIYT 630
gi 354480824 607 DRVNSEVLGATRVTRHRNILAERWEAGIYA 636
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap