Conserved Protein Domain Family
GCOM2

?
pfam15328: GCOM2 
Putative GRINL1B complex locus protein 2
This protein family is named Putative GRINL1B complex locus protein 2. GRINL1B is short for: glutamate receptor, ionotropic, N-methyl D-aspartate-like 1B. The name indicates what sort of receptor it is thought to be, a ligand gated ion channel specific to the neurotransmitter Glutamate. This family of proteins is found in eukaryotes. Proteins in this family are typically between 325 and 463 amino acids in length. The protein is thought to be the product of a pseudogene with a role in helping assemble a gene transcription unit.
Statistics
?
PSSM-Id: 317701
View PSSM: pfam15328
Aligned: 31 rows
Threshold Bit Score: 126.797
Threshold Setting Gi: 432852394
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 172046249  28 LKRQERLLRNVKFICKLPDKGKKISDAVTKLKAAIAEREEVRGRSELFYPVSLDCKERQKAIA----------------- 90
gi 968069046  41 KERQGKFLTFKKRLDQLPDKGRRLKESYDKLLDEITRRDDVEAAARMLSELNIASKGRVALDN----------------- 103
gi 195062867  35 KDRQSHLLASKNRLQMLPDKGRRIRESYEKLLAEIHSRDEVEATAKLLGELNIASKGKITLNN----------------- 97
gi 170042181  42 KLRQELLLNNKGRVAKLPDKGAKIRLFYEQIVKQLEAHCNVDRAAELFSELNIASVGKRSLTK----------------- 104
gi 170070691  42 KLRQELLLNNKGRVAKLPDKGAKIRLFYEQIVKQLEAHCNVDRAAELFSELNIASVGKRSLTK----------------- 104
gi 332029841  27 LERQKKILANKKFISKLPDKGEKIINFYNKIQKELEHRNEVEEAANVLSRLNIASEGKMAMSKlewtgkynerddenmtk 106
gi 194744715  39 RDRQAHFLSFKKRLLQLPDKGKRLQESYDKLLDEIRKRDEVEQATRLLSGLNIAEKGKVALSNlewngrta-degahvdd 117
gi 195353683  39 KDRQSHFLSFKKRLHQLPDKGKRLQESYDKLLAEIRRRDEVEEATRMLSGLNIVEKGKIALNNlewngrnt-degahvdd 117
gi 195157992  39 RDRQSKFLSFKKRLLQLPDKGRRLQESYDKLLDEIRRRDDVEATAQMLSELNIASKGKIALNNlewngreivdegahved 118
gi 195109632  35 RDRQSNILASKKRLESLPDKGRRIRESHEKLLAEIQRRNDVEATANLLGELNIASKGKVTLNNlewhgkts-pgksdvtd 113
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 172046249  91 VVD--------------G---DRDKAQNSDQILDTSSPV---PGCSSVAnITSSQTTSRQQGLAHPTRGG--DAEAAEA- 147
gi 968069046 104 LEWngkmtd--dhvadiL---DSDDELEMDPLKIIAQGT---MHEKKVKvLPAEVTLITAEDLAEIETFK--GASTSPD- 172
gi 195062867  98 LEWqgrtsdpdsnasdlL---DSDDEQEMDPLRVIAQGS---LHQRQVKiLPPHATLITHEDLAEIESFRldSLDSFRT- 170
gi 170042181 105 LEWsgqlgg--greddgV---DSDDEEETDPLKILAQST---HTEKVVLvAKPEPSLITEQDLKDIEELK--QEQQVE-- 172
gi 170070691 105 LEW--------------SartNVEPALQQRKLANVPGRVpkfPRPRFPGfPEPEVVHSTIKEPAPVLFVT--SP------ 162
gi 332029841 107 IID--------------L---DSDDEE--DPLKILAQPTgtgVHKKKIIhMVPEENLIKPEDIAEIETFK--TD------ 159
gi 194744715 118 I----------------L---DSDDELEMDPLKIIAQGT---MHEKKVKvIPPSASLITAEDLAEIEDFK--KP--TDSp 171
gi 195353683 118 I----------------L---DSDDEVEMDPLRIIAQGT---MHEKKVKvIPPPTSLITADDLADIEEFK--KP--TDSp 171
gi 195157992 119 I----------------L---DSDDEL--DPLRIIAQGT---MHEKRVKvLPPPESLITAGDLADINTFK--KT--ADSp 170
gi 195109632 114 L----------------L---DSDDEQDIDPLRIIAQGT---MHQRQVKvLPPPATLITPEDVVDIASFR--QEQPSDSl 169
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 172046249 148 -----EHTVSEhpTSSsGAPAPsSSQASEGLPQHcaLGQV---EDHPGSSD------------NLFIDRLQRITIADPTE 207
gi 968069046 173 --------------------STvPADLIEVKLSRlaLTKE---SNDSAPAP------------TLPLEQHALYLIDKTEH 217
gi 195062867 171 -----DQSASSscSGQaDGSNAvAAEIIEIDVVTlvGKPP---ATM--------------------LEQHALYLIEKTE- 221
gi 170042181 173 ---------------------CaPAELIEVDVAKsvGKLSsilEKRQQAVV------------NELYDGHAIYICNKErs 219
gi 170070691 163 -------------------APKtPSDPIELPAITatKKQP---QRLPTDFQerppgnrlahliQLDADKLQQYSL--PVL 218
gi 332029841 160 ----------------------------------------------------------------LLDTEHVKYIVDKVE- 174
gi 194744715 172 dsalhDHSDTS----------SlPAEIIEVDASIvaAKLG---KEE-------------------PLEQHARYLIDKTE- 218
gi 195353683 172 dsalaGHSDTS----------SlPAEIVEIDASQvaAKLS---KEL-------------------PPDQHALYLIDKTE- 218
gi 195157992 171 dsaleGQSATS----------SiPAEFVELDACLvaAKYP---QESRS---------------YPPVDQHSLYLIDITE- 221
gi 195109632 170 dssqtNESASS--SGQ-DDSKIiPAEIIEIDVGKlvGNRP---TEAT-------------------LEQHALYLIDKTE- 223
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 172046249 208 HhSEGNRNPENLAGLWSGPQKKPHYMEVLEmRAKN 242
gi 968069046 218 QrSDNDPPVREKF--------KPFRTTVSNvhdpd 244
gi 195062867 222 --LQATATEREKFkpfrttvsnvhdpakertrkkg 254
gi 170042181 220 taqkskylpfrttktdvhqpdkektrhekhlkswe 254
gi 170070691 219 SeWSRNRTLKGGRPARKSIKKKPrlgssipsrgkr 253
gi 332029841 175 --KVQEVKKREPF--------KPY-------KTTK 192
gi 194744715 219 --VNINPSAREKF--------KPF-------RTTv 236
gi 195353683 219 --TNVNTP-REKF--------MPF-------RTTK 235
gi 195157992 222 --PKERSAGREKF--------RPF-------RTTi 239
gi 195109632 224 --LH-AVKDREKF--------LPF-------RTTv 240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap