Conserved Protein Domain Family
Afaf

?
pfam15339: Afaf 
Acrosome formation-associated factor
Afaf is a family of single pass type I membrane proteins. Afaf is a vesicle factor derived from the early endosome trafficking pathway that is involved in the biogenesis of the acrosome on the maturing spermatozoon head.
Statistics
?
PSSM-Id: 317711
View PSSM: pfam15339
Aligned: 10 rows
Threshold Bit Score: 274.028
Threshold Setting Gi: 545201646
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 425906044  63 PANEKTGNYYKDIKQYVFTTPDSKGtkTEVSVTATTDLKFTM-KDYKSSKATAS---------GEEDKRSEPSRKSST-- 130
gi 147742919  64 PANEKTGNYYKDIKQYVFTTPNIKG--SEVSVTATTNLEFAVkKNYKASKPTAS---------GEEEKPSESSRKTST-- 130
gi 147742918  53 PANEKNGNYYKDIKQYVFTTQNPNGteSEISVRATTDLNFAL-KNDKTVNATTYeks----tiEEETTTSEPSHKNIQrs 127
gi 675638085  55 PANEKNGNYFKDIKhYVFTTQNPNGteSEQSVRATTDLNFAL-KNYKIVNATTFeks----anEEETTTHEPSRKNIQkp 129
gi 281346924  75 PANEKSGNYYKDIKQYVFTTQNPNGsqSEISVRATTDLQFAL-RNYKLVNETTIspt---gkgTSEENPTEHYGKKTRrp 150
gi 440888884  59 htpEKTGDHYKDVKQYVFTTQNPNGtqSEISVRATTDLNFSL-RNYKLFNETTTtappeivshE-------------Ekg 124
gi 545201646  49 PANEKSGNYYKDIKQYVFTTQNPNGthSEISVRATTDLNFAF-KNYQLVNETTTappe--svtNEEETFEEPTENNIPks 125
gi 562827010  66 PADDNSHENFRDVKQYVFTTQNANGseSEISVRATTDLKFAL-KNYKMINKTTSekp----isEEEKSVPESSHKNIQks 140
gi 655600068 218 PANEKSGNYYRDIKQYVFTTHNPNGseSEISVRATTDLRFAL-KNYKLGNASAEk--------PSEEKPSEPSHKNIQrt 288
gi 350579166  44 PANDKTDDYYKNTKQYVFTTQNPNGtqSEITVRATTDLNFSL-RNYKLINETTTlpppertenEEEKTtq---------- 112
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 425906044 131 ---PNVPAFWTMLAKAINETaVsMD--DKDLFYQAIPASDLNSTN----EDQLSELEEIKLKLMLGISLMTLILLIPLLI 201
gi 147742919 131 ---PNIPAFWTILSKAVNETaVsMD--DKDQFFQPIPASDLNATN----EDKLSELEEIKLKLMLGISLMTLVLLIPLLI 201
gi 147742918 128 --tPNVPAFWTMLAKAINGTaVvMD--DKDQLFHPIPESDVNATQ----GENQPDLEDLKIKIMLGISLMTLLLFVVLLA 199
gi 675638085 130 --tPNVPEFWTMLAKAINGTtVvMD--DKDQLFLPVPESDVNATK----EENWPDPEDLKIKLTLGILLMTLLLFVLLLA 201
gi 281346924 151 skgPNEPAFWTMLAKALNATpTaEEieEKDQLFRPIPNSDLNATS----EDTLTKLQEIKLKLMLGISLMTLFLFVILLA 226
gi 440888884 125 tqsPNEPAFWTMLAKAINATtSeDN--QRDQFFHPIPNSDVNTTW----EDNTARIQEAKLKLMLGISLMTLFLFVVLLA 198
gi 545201646 126 tqgQNEPEFWTNLAKALNATtNeENd-GKNELFQPIPSSDVNATN----EDKLAELQEVKLKLMLGISLLTLFLLVTLLA 200
gi 562827010 141 tpnvpe--fwtklakAISETtKsMD--DKDQLFQPIPSSDVNATNeeeeEEELSELDEIKYKLMLGISLMTLILFATLLA 216
gi 655600068 289 --tPNLPEFWTMLAKALTQStSgFE--GND-LFKPIPGSDVNATN----QDKLSELQEIKLKLMLGIALMTLLLFVTLLA 359
gi 350579166 113 --gPNEPAFWTMLAKAINAT-T-EDn-ERDQFFHPIPNSDLNPAN----EDNLAKLQEAKLKLMLGISLMTLFLFVIILA 183
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*.
gi 425906044 202 FCFATLYKLRHLRDK-TCES-QYSVNPELATLSYFHPSEGSNQTVL 245
gi 147742919 202 FCFATLYKLRHLRDK-SYES-QYSINPELATLSYFHPTEGVSDTSF 245
gi 147742918 200 FCSATLYKLRHLSYK-SCES-QYSVNPELATMSYFHPSEGVSDTSF 243
gi 675638085 202 FCCATMYRLKYLRYK-SCES-QYCINPELASKSYFHPLKGVSDTSF 245
gi 281346924 227 VCSAMLYKVKTINYKsRYQT-EYTVNPELATLSYFHPSEGVSDTSF 271
gi 440888884 199 ICSAMLYKMKMMKYKqACQTgEYSVNPELATLSYFHPSEGVSDTSF 244
gi 545201646 201 IGSAMLYKVKLRNYNkTSQS-EYSVNPELAALSYFHPSEGVSDTSF 245
gi 562827010 217 FCSIMLYRMKQLSYK-SCQS-EYTINPELATLSYFHPSEGISDTSF 260
gi 655600068 360 FCSATLYNLKQLSYK-SCES-QYSINPELATLSYFHPSEGVSDTSF 403
gi 350579166 184 VSSAMLYKMKTMKYEkSCESgEYSVNPELATLSYFHPSEGVSDTSF 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap