Conserved Protein Domain Family
FAM212

?
pfam15342: FAM212 
FAM212 family
This domain family is found in eukaryotes, and is approximately 60 amino acids in length.
Statistics
?
PSSM-Id: 317713
View PSSM: pfam15342
Aligned: 10 rows
Threshold Bit Score: 80.2454
Threshold Setting Gi: 1023024680
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 432858161  235 DDGSDWTSSLMSRSRNRQPLVLGDNVFADLVGNWLDLPEV 274
gi 148222385  181 ADSQDWTGCLLSQSRSRQPLVLGDNSFADLVKQWMDLPEN 220
gi 736300420  165 SNPEDWTTSLLSRSRNRQPLVLGDNSFADLIKNWMDLPEC 204
gi 532104163  131 VEPDDWTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPEL 170
gi 334323894  120 AEPDDWTSTLMSRGRNRQPLVLGDNVFADLVGNWLDLPEL 159
gi 733921830  147 DESHDWTSSLMSQSRNRQPLVLGDNIFADLVGNWLDLPEL 186
gi 768945789  233 DDSCDWTSSLMSSSRNRQPLVLGDNVFADLVGNWLDLPEV 272
gi 556999348  182 PDSNDWTVSLLSQSRNRQPLVLGDNCFADLVENWMDLPET 221
gi 637270625  167 VDAGDWTVSLLSQSRNRQPLVLGDNCFADLVENWMDLPEE 206
gi 1023024680 109 LDAEDWTASLLSRSRSRQPLVLGDNCFADLVENWMELPEA 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap