Conserved Protein Domain Family
PAG

?
pfam15347: PAG 
Phosphoprotein associated with glycosphingolipid-enriched
PAG, or Cbp/PAG (Csk binding protein/phospho-protein associated with glycosphingolipid-enriched microdomains) is a transmembrane family that has a negative regulatory role in T-cell activation through being an adapter for C-terminal Src kinase, Csk. This family of proteins is found in eukaryotes.
Statistics
?
PSSM-Id: 317718
View PSSM: pfam15347
Aligned: 13 rows
Threshold Bit Score: 397.664
Threshold Setting Gi: 410911904
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84029385     2 GPAGSVLS-SGqmQMQMVLWGSLAAVAMFFLITFLVLL-CSTCDREKKPRq--HSGDHENLMNVPSDKDMFSHSATSLTT 77
gi 84029384     2 GPAGSLLG-SG--QMQITLWGSLAAVAIFFVITFLIFL-CSSCDREKKPRq--HSGDHENLMNVPSDKEMFSRSVTSLAT 75
gi 326917817    2 GPDSGFLS-SG--RVHVILWGSLAAVTTLLFLTFLIFL-CSSCNREKKSKh--QNGDHENLMSVPSEKEVFSHSITSSAT 75
gi 620969681    2 GPAGGLLS-SG--QVPVVFWGSLATVGTFLLLLTFLLFlCSSCDREKKPK---QSGDHENLMNVPSDKGLLSHSVTSLTT 75
gi 301614380   10 GSPSNDLS-GE--QAAFMAWGGLAAVSTIIFLSILLFL-CSSCYREKKKKh--QNGDHENLMTAPSDKETYSHSVTSLGT 83
gi 556982757   10 GDEEGLLS-SG--QPQVVLWGTLAAITSFLLLNLLVFL-CTSCEREQKAKt--QTEDHEILMNMPSDKETFSHSVTSLGT 83
gi 558185320    2 GPSGSLL--GG--HLQIALWGSLAAAATFFLITFLIFL-CSSCDREKKPRq--YSGDHENLMNVPSDKEVFSRSVTSLAT 74
gi 731464933    6 GPVGSMLSiSG--QVQIVLWETLAAVAIFFLIAFLIFL-CSSCDREKKPRp--QSGDDENLMNVTSDKEMFSHSVTSLAT 80
gi 410911904   22 aadaGAALwSG--GVQLVLAVVLSTLTLLLLVSVLLLL-CASCQGQKKAAngpEEGDHENLMNGVPQKETGSQSAESPAT 98
gi 542211406   22 aastgvaSwLG--SGQLILIATLSILTALLLVSVLLLL-CASCQGQKKAVnghPAGDHQSLVNGVSERDV-SQSADSPAT 97
gi 1033400546   2 GPDVGFFS-TS--LLHIIVWGGLAAMTMLLVLIFLIFL-CSSCDREKRPKq--LNGDHENLMNVPSDKEVFSHSVTSLAT 75
gi 971384407   32 GPDSGFLS-SG--RLHVILWGSLAAITTLLFLTFLIFL-CSSCNREKKSKh--QNGDHENLMSVPSEKEVFSHSITSSAT 105
gi 821464651    2 GPEGSLLH-GG--QVHIIIWGSLAAVATFLLITFLIFL-CSSCEREKKPKq--QNGDHENLMNVPSDKEMFSHSVTSLGT 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84029385    78 DALASSEQNGVLTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKA-KCHQSRELPRIPPENAV--DEILTARAAD 154
gi 84029384    76 DAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKP-KCHQSRELPRIPPESAV--DTMLTARSVD 152
gi 326917817   76 EPPPSSEQNGALSNGDVLSEDSTTACIQPYEEVQTSISDLLE-QDSLGKSlKCHQSRELPSIPPNNTM--ETIISARNAE 152
gi 620969681   76 DAAASSEPNGGLSNGDILSEDSTKAYTLPYEEVQTSVSDLLDSQESVGKSiKCHQSRELPRIPPNGTL--EPILPPRTEA 153
gi 301614380   84 EAPASY-RNGAVSNGDV-SEDSSAACIQPYEDVQGSLPDLCDLQDCTSKSiRCHQSRELPRIPPNSNL--ETISPAEDDE 159
gi 556982757   84 DPPVSSCQNGELSNGDVLSEDNAGTNTQPSEEMKTSLPDLISQQDSMGKPlRYPQSRELPSIPPNSSV--EGPKSSNATE 161
gi 558185320   75 DAPLSSDQNGALTNGDIASEGSAGTCAQHYEEVLAAASDLLDAQDGSGKP-KGHQSRELPQIPPDSAV--DTLASTGSVD 151
gi 731464933   81 DALASSDHNGALTNGDILSEDSTMTCMQHYEEVETSASDLLDSQDSAGRPsKCHQSRELPRIPPNSTV--DTTVNASSVD 158
gi 410911904   99 DVAVSSSRNGPLTSGTil-tDTQDSSPQPSEEILSSQSEL--------RSsKCPQDRELPSIPPDNAL--AGPPASGDST 167
gi 542211406   98 DAAVSTSHNGPLTSGTILT-DTQDTSPQLSEEMLSSQSEL--------RSsKCPQDRELPSIPPNNALigNGPPPSGDST 168
gi 1033400546  76 DPLASSEQNGGLSNGDVLSEDSTTACIQPYEEVQTSVTDLLEPQDSLGRSlKCHQSRELPRIPPNNAI--ETILSTRNTE 153
gi 971384407  106 EPPPSSEQNGALSNGDVLSEDSTTACIQPYEEVQTSISDLLE-QDSLGKSlKCHQSRELPSIPPNNTM--ETIISARNAE 182
gi 821464651   76 ELPASSEQNGGLTNGDILSEDSTMTCMQHYEEVQTSISDLLESQDSTGKSaKCHQSRELPRIPPNDTL--DTILTTSNVE 153
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84029385   155 TELGPGVEGPYEVLKD--SSSQENMVEDCLYETVKEIKEVA-----D-------------------KGQGG--KSKSTSA 206
gi 84029384   153 GDQGLGMEGPYEVLKD--SSSQENMVEDCLYETVKEIKEVAaaahlE-------------------KGHSG--KAKSTSA 209
gi 326917817  153 NDQGLGMEGPYEVLKD--SSSQENIVEDCLYETVKEIKDVGaaanmE-------------------RSCNR--KSAASMM 209
gi 620969681  154 RERGLGTEGPYEVLKV--SCSQENMVEDCLYETVKEIKEAGasadaD-------------------PSHGGghQEGSATA 212
gi 301614380  160 NELPLGNEGPYEVLKD--SSSHENIIEDSLYETVKEIKDAHalplnE-------------------ETERS--------- 209
gi 556982757  162 NDQALVTDVTYEVLKD--SSSQDNIIEDSLYETVKELKEECgparnD-------------------TASLS--RPSTTAE 218
gi 558185320  152 GDQGAGAEGPYEVLKD--SSSQENMVEDCLYETVKEIKEAAap---------------------pgKGPGG--RSRAAPA 206
gi 731464933  159 GDQSGGMEGPYEVLKD--SSSQENMVEDCLYETVKEIKEVGatthpD-------------------KGHNG--KSKSITT 215
gi 410911904  168 ----------YEVVKEiaATSRDVSAEDSLYETVKEIKDPPahlglPngttqpspdvpphhphallNGHLS--------- 228
gi 542211406  169 Y----------EVVKEmaVASRDVSADESLYETVKELKEPAaeaglPngtiqpspdeppphppallNGHVS--------- 229
gi 1033400546 154 NDQGLGMEGPYEVLKD--SSSQENIVEDCLYETVKEIKELGatsgtE-------------------KC-----KPKTAVL 207
gi 971384407  183 NDQGLGMEGPYEVLKD--SSSQENIVEDCLYETVKEIKDVGaaanmE-------------------RSCNR--KSAASVM 239
gi 821464651  154 SDQGLGMEGPYEVLKD--SSSQENMVEDCLYETVKEIKEVGtsanlE-------------------KGQNG--RPNSVTA 210
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84029385   207 LKELQGAP-MEGKADF-----AEYASVDRNKKCRHSANAESILGT-CSDL---------DEESPPPVPVKLLDENANLPQ 270
gi 84029384   210 SKELPGPQ-TEGKAEF-----AEYASVDRNKKCRQSVNVESILGN-SCDP---------EEEAPPPVPVKLLDENENLQE 273
gi 326917817  210 VTEDQDQI-PECRIES-----AEYASVDRNKKSRQSANSESPLDN-TPDI---------EDELPPPVPMKLLDENENVQE 273
gi 620969681  213 GRGLLGSV-SEGQTGS-----AEYASVDRNKKGRQSLSAESVLGG-LADL---------EEEAPPPVPVKLLDENENVWE 276
gi 301614380  210 ----MDAV-SPKRQEFrieagAEYASVDHNRKSRQSINTQSAGST-PTSQ---------EEDVPPPLPKKLLDENENVQS 274
gi 556982757  219 EVEAQSPEnAAGATQS-----AEYASVDWNKKSHRSQVLCAGDRA-SANS---------DEEAPPPVPTKILDENENVQN 283
gi 558185320  207 PKEPPAPQ-APGRADF-----AEYASVDRNKKCRQSMNVDSVLGP-ARDA---------EEEAPPPVPVKLLDKNENLQA 270
gi 731464933  216 LKELPEPQ-TQGKMEF-----AEYASVDKNKKCRQSANSEIVLGS-SHDP---------EEETPPPVPVKLLDEKENLQE 279
gi 410911904  229 ---------PVTPERGplctgAEYASIDLKKKSRHSADMESKRRSnNANVpshgp-peepEDLPPPVPEKVLDENDN--- 295
gi 542211406  230 ---------PSTPERGpifagAEYASVNLNKKSRHSADMEAKRRSgNAAVpqqkpqeepEEDLPPPVPEKVLDENDN--- 297
gi 1033400546 208 VNGSLDHV-LAHKVES-----AEYASVDRNKKSRQSANSESPLSN-TPDV---------EDEPPPPVPLKLLDENENVQE 271
gi 971384407  240 VTEGQDQI-PECRIES-----AEYASVDRNKKSRQSANSESPLDN-TPDV---------EDELPPPVPMKLLDENENVQE 303
gi 821464651  211 FKEIQGPQ-VLNKIES-----AEYASVDRNKKSRHSVNAESILGN-SVDV---------EEEAPPPVPVKLLDENENVQD 274
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84029385   271 E------G------GGQA-EEQAAEGTGGHSKRFSSLSYKSREEDPTLTEEEISA-MYSSVNKP-GQSahkp-------g 328
gi 84029384   274 K------E------GGEA-EESATDTTSETNKRFSSLSYKSREEDPTLTEEEISA-MYSSVNKP-GQLvnks-------g 331
gi 326917817  274 N------E---------VdEGEGTEGASKPEKRLSSMSYKSREEDPSLTEDEISA-MYSSVSKP-GQA------------ 324
gi 620969681  277 K------Eder-saAVKEeEGEASESPVDTSKRLSSLSYKSREDDPALTEEEISA-MYSSVNKP-GLA------------ 335
gi 301614380  275 KepeaepE------AEPEaLKENIEGASQDDKRQSLVSYKSREEDPCLTETDISA-MYSTVSKTsGQS------------ 335
gi 556982757  284 K------G------T----EGEHLKEASEVEKK--RLSYRVHGDGPPLTEEEISA-MYSTVNRP-AQS------------ 331
gi 558185320  271 Q------------------DNSASEGTQETNKRFSALSYKSREEDPTLTDEEISA-MYSSVNKP-GQS------------ 318
gi 731464933  280 K------E------ERPAdEEGATEGTTEINKRFSSLSYKSREEDPTLTDEEISA-MYSSVNKP-GQSvnkpgqsvnksa 345
gi 410911904  296 -------Qpvl-vnGSAGaGLHNGE-------LDSPLSPAPGIDSPTLSDKE--ApLYSSVAKtnc-------------d 345
gi 542211406  298 -------QpalmmnGLAEaGLHNGE-------LHSPPSPAPKFDNHVLSDNE--SaVYSTVNKtnc-------------d 348
gi 1033400546 272 K------E--------AEeEKEATEGPSDPDKRLSSLSYKSREDDPSLTEEEISA-MYSSVNKP-GLA------------ 323
gi 971384407  304 N------E---------VdEGEGTEGASKPEKRLSSMSYKSREEDPSLTEDEISA-MYSSVSKP-GQA------------ 354
gi 821464651  275 K------V------DGETvNKGATESTGQINKRLSSLSYKSREEDPTLTEEEISA-MYSSISKP-GQT------------ 328
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 84029385   329 pcMKGPE--SACHSMK-GLPQRSSSSCNDLYATVKDFEKTPNs-iSTLPParRP-SEEPEPDYEAIQ----TLNREDEKV 399
gi 84029384   332 qsLTVPE--STYTSIQ-GDPQRSPSSCNDLYATVKDFEKTPN---STLPPagRP-SEEPEPDYEAIQ----TLNREEEKA 400
gi 326917817  325 --IRAMD--SPYTCIQeITSQRSPSVCSGLYASVKDFENTLSa-tTVPQSagRP-NGELEPDYEAIQ----AVSQDEDRT 394
gi 620969681  336 --NRLAP--APSVAIQeVGPPRSPSSSNDLYATVTDFENLTDg-qEPPPP--RR-DNEPEPDYAAIQ----SLGRDEGRA 403
gi 301614380  336 --FELQEefSHYAYIQdIAQDTSPTTCNGTYATVRDLDKSPDs-iAGPHAmdKA-NGGPDPEYEAIA----NLSREEERT 407
gi 556982757  332 --VKSLE--CDYVEVKaLSLERTPSMNSDLYATVRDFEKEPNvlwPTPSPsdQTiQQETDPGYEPIS----SVKNEDETT 403
gi 558185320  319 --LKVPE--SSDTCSP-GAARRSPSSCNDLYATVKDFEQPPSg-aGTLAPaaRP--REPEPDYEAIQ----ALSREDEKA 386
gi 731464933  346 qllqVPE--SSYTCIQdGAPQSSPSSCNDLYATVKEFEKAPNs-vSTPPPaeRP-SVEPEPDYEAIQ----TLNREEEKA 417
gi 410911904  346 eaVKEEDkeHDYSSIAeIKGLVTSSS--DLYATVRDIYSQPEq-pEEPA------LDGTDPGYETIRlpktSSSDDDRRA 416
gi 542211406  349 daVNEEDkeHDYSSIAeIKGLVPASSSGDLYATVRDIYSQPDe--pGPA-------DSTDPGYETIRipktNSSEDEHRA 419
gi 1033400546 324 --TRDLE--PAYTCIPeIAPQKSPSICSGLYASVKDLENTPNi-tTFPQSgeRL-NGELEPDYEAIQ----TVHHDEDRN 393
gi 971384407  355 --IRAMD--SPYTCIQeITSQRSPSVCSGLYASVKDFENTLSt-tTVPQSagRP-NGELEPDYEAIQ----AVSQDEDRT 424
gi 821464651  329 --LKVPE--STYSCIQeVAPKRSPSSGNDLYATVRDFEKNPN---ILPPPgvHS-NGEPEPDYEAIQ----SLNKDEEKT 396
                         490       500       510
                  ....*....|....*....|....*....|...
gi 84029385   400 PLETNGHHV--PK-ESDYESIGDLQQCRDVTRL 429
gi 84029384   401 TLGTNGHHGlvPK-ENDYESISDLQQGRDITRL 432
gi 326917817  395 LSVPHTNHIapSG-ENDYESIGDLQHHRDVTRL 426
gi 620969681  404 GPGPERGRPlpAQpESDYESIGDLHHGKDFTRL 436
gi 301614380  408 MLYTNAGQTllAHgESDYESIGDLVQNGDFTRL 440
gi 556982757  404 ESQLSASPAtdQKiENDYEIISEFQKD-EITRL 435
gi 558185320  387 TLEPSSLRGpfPK-ENDYESIGDLQQCREVTRL 418
gi 731464933  418 TQETNGLHVlfPK-ENDYESIGDLEQCRSITRL 449
gi 410911904  417 GAGEEGPDAatA--EPDYECVGEVGLTGEMSRL 447
gi 542211406  420 ----EGSDVgkA--EPDYESVGELGLGPEMSRL 446
gi 1033400546 394 GLIPHSSQStlSQ-ENDYESIGDLQQHKDVTRL 425
gi 971384407  425 LSVPHTNHIalSG-ENDYESIGDLQHHRDVTRL 456
gi 821464651  397 VSMANGNHItfPK-ENDYESIGDLQQSKDITRL 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap