Conserved Protein Domain Family
K1377

?
pfam15352: K1377 
Susceptibility to monomelic amyotrophy
This family of proteins is associated with a susceptibility to monomelic amyotrophy.
Statistics
?
PSSM-Id: 317722
View PSSM: pfam15352
Aligned: 20 rows
Threshold Bit Score: 760.022
Threshold Setting Gi: 847098188
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   105 QQRKQKFEEVTEKFQRAHVPLSQRRKA---VS--RKPVPPLEEALKQIQESNLKSEVNLPFSRRPTINWRAI---DSAL- 175
gi 1018971876  374 lgcvprlpqfsaaspnillpvkpsppprssgglpspgpdhlatetsssssisssptpsssspppsIAFSPSIltmDFPL- 452
gi 395520423   100 QQRKQKLEEVTEKFQRAHVPSSQRRKT---VY--QKPVPRLEEALEQIQGFSLKQESNFSSSKRPTINWKTI---DSAV- 170
gi 1023003151  102 QQRKQKLEEVTEKFQRAHIP-PQRKKT---VN--QKTVPRLEEALEQIQRFSLKPEFNYSSSNRPTMNWKNI---DSAV- 171
gi 1033396553      --------------------------------------------------------------------------------
gi 847098188    72 QQRKQKLQEVTEKFLRAHLPPSQRRRTayvLH--KKPTPKLEDALNQIQGSVTPSFYYLSNNTHPA-HTRNT---DTPSs 145
gi 902887924   130 QQRRIKLQEATERFQRAHLPASQHKQI---ALvqTKAAFQLEEALEQIKGSVLTSGLYLPSRNKTTFRA--T---DDTS- 200
gi 532086935   105 QQRKQKFEEVTEKFQRAHIPFSQRRRT---VF--PKSVPPLEEALKQIQESNLKSEVNLPLSHRPTINWRAI---DSSL- 175
gi 513019122   105 QQRKQKFEEVTEKFQRAHIPLSQRRRA---VF--QKPIPPLEEALKQIQESNLKSEVHLPFAHRPTISHRVI---DSTL- 175
gi 564309548   100 QQRKQKFEEVTEKFQRAHVPVSQRRRA---V-------PPLEEALKQIQESNLKPEVNISLSHRPATNWRAI---DSAL- 165
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   176 PSALSKNDHKHQKQLLSKI---NCEKEMNENmRATLATSK-NVFQLKLEETQKLLEDQHLSNLQKFGDEVNQITNSETLS 251
gi 1018971876  453 ASAVTRIGSRYQNHHSDEV---NFNEEMPEN-KANLDFDR-VLFQQNLEETQRLLEDQHLSSLQHVHQEVNHPINSETLS 527
gi 395520423   171 ASAVSKIEPMYQKHLSSRI---YSDKDKQENiKISWAVGQeDSFQHNLEETQHLLEELHLSSVQDLHEEVNQLTNSETLS 247
gi 1023003151  172 ASVVTRIEPMYQRHLSSRVnwsNCDREMQENsKINLTVGQeDNFQHNLEETQQLLEELNLNNIRDLHEEVNQLTNSETLS 251
gi 1033396553      --------------------------------------------------------------------------------
gi 847098188   146 ISSVGQETWHKKHQATTKL---GCEKTLQEKsAIQLDSNQ-LYFQHRLEEAQRLLEEQHLSNLQNFYHEVEHLARSESLS 221
gi 902887924   201 STSASRNGYSHQEQISAMV---GCNNTMQESsTTSMDSNQ-LLFQKNLKEMQQLLEKQHLSNLENFhQEVEKTDDSESLS 276
gi 532086935   176 PSTLSKNDHKNQKHLLSKI---SCDKEMKENsMANVAANK-NVFQLKLEETQKLLEDQHLSSLQNFCDEVNRITNSETLS 251
gi 513019122   176 PSALSKNDHRHQKHLLSKI---NWDTEMKENnMVNLATNK-NVFQLKLEETQKLLEDQHLSSLQRFCDEVKQITNSETLS 251
gi 564309548   166 PSALSKNDYKHQKPLVRRI---NHNKEMKENnIASLATNR-NVLQLKLEETQKLLENQHLSDLQKFCDEVNQIANSETLS 241
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   252 SIDSLEA-TE--HEEIYLTLNKEHSTSIQRNTISLKPANMQSTNLSCFDEDKLAFSKTQ-HINNWLTNLDASNTQNVTAF 327
gi 1018971876  528 SVDSLEA-GE--HNEIYETLTKAPSFSTKWNSISRDSQSPQSRDQSCFGSDEMTLSKMR-HVNNWLTNLGDENPQAATPF 603
gi 395520423   248 SIDSLEA-GD--HEEIYSTLSKALSSATQQNSISHNSQSPQTTNQVYFDAGELHLSKTQ-HINNWLINLGDQNTQTASPF 323
gi 1023003151  252 SIDSLEA-GD--HEEIYSTLGKAPSSAIQQNFVSHSSESPQPTNQVNFDAGELHLSKTQ-HINNWLINLGDQNIQTASPF 327
gi 1033396553    1 ------------mepggggggsgsdpssgserpaetwrrgregeglrkglsesavprglgrrawaaffpssgpnlkvlle 68
gi 847098188   222 SVDSLEEeREvkAEENIAALNLQHAFSAI-DVFPLDNVTVEASN------------KYQgHTETVNVLHSQSNTTSNHLS 288
gi 902887924   277 SLDSLEA-GE--QNGNCTP-PSESPLTTQCDCAQYNPGKSQTRSNDLIYTTE-NTSKNI-HLNNCQRNLDSQNSHNNLPV 350
gi 532086935   252 SIDSLET-GQ--HEEVYLTLNKEPSTSIQQNSVSLKLANLQSTNINCFDEDKLLVSKTQ-HINNWLTNLDAQKTQSVTCF 327
gi 513019122   252 SIDSLEA-GE--HEEIYLAFNKEPATPIQQDSVSLKSANLQSTNLNHFDEDKLSFSKTQ-HINDWLTNLDAQNTQPVIPF 327
gi 564309548   242 STDSLEA-GE--REEIYITLSMEPSTSTQQNSVPLKSANLQSAHLNCFDEDKLSFSKTQ-HINNWLTNLDAQNTQPVVSF 317
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   328 SDILSKSNVlPSWEYFNSKEQNPSPLNGTVERATnt--aNNSVPFVS----SPPMFVLDKKCEKTSETSTMRTTDS-TSG 400
gi 1018971876  604 DAILIKPSVlTPSEHLNHREQNSPAPTGCGQRLT-----ADTASSGN----GPGTFKRGKNKEKNSEPSTTWKADSlSSG 674
gi 395520423   324 PDFINKHN-----DHFNNPKLKSFALNRIGERSTda--sDNTVAIIH----SPCTFAQDKKAEKTSETFSIWKIDSlSSR 392
gi 1023003151  328 PDFINKHN-----EHFNNTKLKSFAFNKVADRSTda--sDNTVAFIH----SPCTFSQDKKAEKTSETCSIWKVDSqFSR 396
gi 1033396553   69 rdlskerhellkdqrlfhtqarklsvetnkrrraleekwkedeqkeqkfreqillqrkqkhqeaterfqrshlpssqrks 148
gi 847098188   289 PDRMA------TDIRLDGKDPDVPIGHGQKDIVTnt-ftQNGILFPQksqiSSAQNIENLREKNNSHYYKTAVSELdSKE 361
gi 902887924   351 RDLLAKHNVlILAEHVNSSGEESSVSHRSEKKAAefftsGNQESSVN----KAFTFLQNIKEERRNPSSGTART------ 420
gi 532086935   328 SDMLSKSNVlPVWEAFNNKEQNPSTLNRTVQRVTst-anNNSVAFLY----SPPIVELDKKSEETSEASTMRTSDS-TLA 401
gi 513019122   328 SDILSKSSVlSSWEHFNNKEQNQSTLCRTVERSTst--tNNSVASVY----SPPVVVLNKKTEENSEVSTTKTSDF-TSG 400
gi 564309548   318 SDILIKSNIlPSWECLNSKEQNPPALNRAVGRATrt--tSDSVVFVC----SPSVVALDKK-ENTAENNTVRTNDP-TNG 389
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   401 AFKRERPLVTESPTFKFSKSQSTSDSLTQEVATFPDQEKYSELNQENGTTSIP-----TScvPVATPLVLPS-------- 467
gi 1018971876  675 MFKRERPYITVSPTFQSRKPSITLTTPTREAVQISDSEGNTEFSQRRRTVAHA-----SN--PPATPLIVPVgqwsdctd 747
gi 395520423   393 MFKRERPLVAESPTFRFSKTWTTSCPSTRETVQSSEHEKCPELTQPNRTTSVP-----ASniPMATPVILPSsqwtnyks 467
gi 1023003151  397 ISKREKPLITESPTFKFNKNWTTSSSTIKEIIQSSEHEKCPELTQLNKTTSVL-----ASnlPMATPLILPSsqwtnyks 471
gi 1033396553  149 gggvqgktepkldealqkiqatgffpfrvterpssatrndrfnwkqnspnvrcdrimqenrrgnlnsgqllfqqnldemq 228
gi 847098188   362 DLLKHLA--------KPTKAWGTPEPTPIQTI----------VPQEKRDPTHPldkqyTPsqPFTSPIIIPSte------ 417
gi 902887924   421 -------LTTGHPVFSPSKAWASPDSIPGERIQDLMQEQSFKMTPQNRSKSVQ-----TFsePIATSGILFPnqrc---- 484
gi 532086935   402 ALKTERPLVTKSPTFKFSKAWTAPDFLNQEVATFSNQETYSKLTQENRGTSIP-----ASfmPTATPLVLPS-------- 468
gi 513019122   401 ALKREKPLVTETPTFKFSKAWTTPDSQTQEVSTFSDQEKYCQLTQENRTASVP-----TSfvPMATPLVLPF-------- 467
gi 564309548   390 ALQRERPPRTESPTFQVSRAWTTPESLTQEATLFSIQERPSKLTWESKTTSSP-----ASsaPVLSP------------- 451
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   468 ---NIQSARPSAKNsIHIKEIDAVQCSDKLDel--kdGK------------------------------EEEIKYFNCNK 512
gi 1018971876  748 tynSTCTISSLRKN-VHIQGTHAMQCADYLG------YN------------------------------DEKVQDFEGNE 790
gi 395520423   468 tysNTHSTSFLQKNnMHLEEICPIQCTDGLDnl--kdLK------------------------------DEKMKNFGSNN 515
gi 1023003151  472 tfnTIHSPSSLQKNnMHLEEICPIQCTDGIDil--kdLK------------------------------DERIKNFGSNY 519
gi 1033396553  229 qqlqeqhfsnlqdfhqeVNEITRSESVSSVDsleageRNescatlsetsslsaqldssctnhritnilmKKDVEHVNTEE 308
gi 847098188   418 ---------wVPKCeFK-KDRHPEEMHSELSva--saGN------------------------------G---------- 445
gi 902887924   485 stgVPSTADTLPKD----KNISKDFFKNTLGkv--ieTK------------------------------EENIRCVDDVD 528
gi 532086935   469 ---NTQSARPLAKNnIHIKEIDPVQCSDKLEel--kdVK------------------------------DERIKYFNFNK 513
gi 513019122   468 ---NRQSARPLAKSnIHIKEIDPVQCSDKLDel--kdVK------------------------------DENIKHFNYEK 512
gi 564309548   452 ---DSQSGGPLAENnTQIKEIDPVQCSDKLDel--kdIK------------------------------HERIIHPNCDK 496
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   513 EELP-LFSDSfqdayi---phnpdsKDEKQKLAETS-SlSNVTSNYD-F-----------------VGQHKKMKYNIHER 569
gi 1018971876  791 REGPfSVPDSpsasdvfskpnqperKEQNDTGMAVSsP-SSGTSLSD-L-----------------VEQHKKMNQSSHER 851
gi 395520423   516 QALPfLFPDAlsasfmynnpdqmsmKDKNEKTVGTTpSlSN---NSD-L-----------------VGQPKKSKHNNHEI 574
gi 1023003151  520 QALPfLFPDAlnspymfnnsdqmavKDKNEKAIGTTpSlST---NSD-L-----------------IGQPKKTKHTNHEK 578
gi 1033396553  309 T----LLEEAsegssd------qqksngKEKVNENIlFlPQGDLLVN-L-----------------SDFDQQKTDHTGER 360
gi 847098188   446 -----VIANNvemhlverkqnksveTPSELSVHESSpIfSPMNNNGS-LgtenephlalrdtqvgwPSQCKKAKNSFAEK 519
gi 902887924   529 QGLS-LFQDasvlcnv---kqqnnkEEEKANVVETMsLvSDTELSXXxC-----------------SAQHKTLKNKIYDR 587
gi 532086935   514 KEFP-LFSDNvqatyl---pqnsdsKDKKQKLYESStSlSNVAPSYD-L-----------------FDEHKKIKYNIHER 571
gi 513019122   513 KKLP-LFSDSfqaahi---pqnsdsKDKNQNITETStSlCNKISNYD-L-----------------LDEHKKMKYNIYER 570
gi 564309548   497 EK-S-LLSDNfqttca---lqisnsNDTKQKESGPSaPlCACPPDCD---------------------QH-SVKHNIHDQ 549
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   570 NGVRFLKSILKKESKYEHGYLKALI-INQSFKFGNQKAAAIRDSIELTKE--KGAEIPKT-IKKLRWFDETSN-IENNAE 644
gi 1018971876  852 NGVCLLKSILKKESKYENDYFKALV-VNRGICFGNQTAASIRDSVELTKVkgRGSESQKV-SKKLRWFDEISK-RGIEDE 928
gi 395520423   575 NGVKLLKSILKKESKYENDYFKALI-INRGISLGNQTAAAIRDSVELTKAkgKGSEIQKS-IKKLRWFDEIGQ-TEKEDG 651
gi 1023003151  579 NGVKLLKSILKKESKYENDCFKALI-INRGFNLGNQTAAAIRDSVELTKGkgKASEMQKS-IKKLRWFDEIGP-IEKEGG 655
gi 1033396553  361 KGVKFPKSILKKESKYEPGCFKAVV-VNRGIKFGGQSVSDARDSIELAKIkgKDADIPKN-NKKLRWFDEINRvVEGNDD 438
gi 847098188   520 DENRFLKGILKKGSKYELGYTRA-VgISRILQIGDAGTNALRDSIELFKEk----ENRKTgKKKLRWLDEIDK-LMTEKE 593
gi 902887924   588 KRAKLFRSILKKESKYEPSHFKAVV-MNHGISFGARPVSSIRDSLELAKMkkKSAENEKT-NRKLRWYDQINK-IIMEND 664
gi 532086935   572 NGVRFLKSILKKESKYEHDYFKALI-INQGFKFRNQKAAAIRDSIELTKE--KSAEIPKI-TKKLRWFDETGD-VENNTE 646
gi 513019122   571 NGVKFLKSILKKESKYEHDYFKALI-IKQGFKFRNQKAAAIRDSIELTKEkeKGAEILKT-TKKLRWFDETIH-MGSSAE 647
gi 564309548   550 NGVQLLKSILKKESRYEHNYLRALV-MNQGFKFRHHKAGSIRDSIELTKQkgKGTEISKT-SKKLRWFDESAN-IENGVN 626
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   645 NSHSLKNKTGTTQQHSQQFHIQ--SGAG-SNIISVSTCAVNSAD------------TKKSRED-SISENVTTLGGSGADH 708
gi 1018971876  929 DKGLKKNQTGLTPVLSSPSCVSmeVSAA-NNTRSSPHGTLSSAG------------SETPKGDpLTIPRTASIKESEKDH 995
gi 395520423   652 EN-SLKTGL----ASSQPTSVQtkVSS--TNNFSVHNCAINSAScgnhkdilgimkYENTKGN-SLITKNTTTQMSETDN 723
gi 1023003151  656 EN-SLKTGLISPQASSQPTYVQtkVNT--TSNVSAPPWAINSSS------------YENPKDN-PLIKKTTATQMPETEN 719
gi 1033396553  439 EKCSEQSITEIFQPQVQSPGIQikATASkTNIKSVPFYMLSSVF------------PETHQNS-QISNQTT--GGSNRDN 503
gi 847098188   594 VSNTERNV------------------------------------------------NASPKSQ-SSTESSESLGHQACDP 624
gi 902887924   665 EKRYEKNTSEISS--AQLQCLQtaSDAP-WTNLNMVVHSSNTTF------------TRNHQENsHISKPNVNSGTSNEEC 729
gi 532086935   647 DSHSLKNRTRMTQPWSQELHIK--SGAG-NSLTSVPACAVNSN-------------RKKSKDD-SLSENVTALGGPGTDH 709
gi 513019122   648 DTHSLKNRTGIIRQWPQQFHTQ--SGAG-SNIINGPACAVNSAD------------RNKSED---ISENVSTLGGSGKDH 709
gi 564309548   627 NSHPMKNRAGMAPQCFQHCHPN---SVT-CNLTSFPECPVHSAG------------GKKAKAD-SVSENVTDLGGYEMDS 689
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   709 MPLNCFI--------------PSGYNFAKHAWPASKKEESKIPVHD-DSKTKQGKPQRGRAKIIRKPGSAKVQSGF-ICT 772
gi 1018971876  996 VPLNSLV--------------PSGYRFAKQAWLASKSAAGKLSVSAeETKSPKSSPRRGKPKVIRRARYAKGPSAF-TCK 1060
gi 395520423   724 VPLHSFV--------------PSGKSFTKQAWITSKKEEGKFPVRNnDSKTQKTIPRSGIIKLIRRSRACKVQSGI-TSK 788
gi 1023003151  720 LSFDAFV--------------PSGKSFAKEAWMISKKEEGKFPVYSsDSKIQKTIPRSGIIKLIRRTRAPKVQSGI-ASK 784
gi 1033396553  504 VIQSNFG--------------SSGYHVAKQAWMAPRGEEIRSALHNcDSKNPKNNPRKGRTKTIKRPKSAKSQSTTsVIK 569
gi 847098188   625 APTGSVAetakisnghcgsvhSTGFHVAKQAWQTNKGLEIIATDCNnNRNVPK-----GKTKFVRRPKSAKNQSSV-LHK 698
gi 902887924   730 MSLNTFM--------------STGSSFAKKAWVVSKDEEGKRPVCNnKSKIYKGNQHKNKPKITRRPRPVRAQSGF-MLK 794
gi 532086935   710 APLNSFI--------------PSSYNFTKQAWLASKKEENKITMRNgNSRTPKGNPHRSGAKVIRRTGSAKVQSSF-MYT 774
gi 513019122   710 VPLNCFV--------------PSGYNFTKQAWPVS-KEESVSPVHNsDSKPQKSRPQRDEAKIIRRTGSAKVQSGF-IDT 773
gi 564309548   690 VPLNSSE--------------SSGYSFAKQAWSPCRKEESKSPVHAsDSKIQKAKPQRG-TKFTRRTGSAKVQKSL-VHV 753
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   773 NRKGAVIQPQSASKVNIFTQAQGKLIIPCPPPQSTSNIRSGKNIQVSQCQP---VTPE-NPQNIITH-NSFNSKHVLPTE 847
gi 1018971876 1061 SRKGAVIRPQSARDTNRVIQTQGKILIPHPPPPLTSISRMGKNALDSPCQP---VKCP-ESQKNASH-PYLHSKWDSSPK 1135
gi 395520423   789 NKKGTVSRPQTTNEANK---TQGKLIAPHPPHKPVTNSRISKIVKDSQCPQ---VMPT-KSQSSTISsKNLGSRYVFPTE 861
gi 1023003151  785 SKKSNDIRPQSTHEANKIITTQGKLTAPHPPYKTITNNRNNKTVKDSQCQS---VIPT-KSQSSTINsRNLGSRYVLPTE 860
gi 1033396553  570 NRRGTIIRPQSASEAPKVMKAQGKIIVPHPPCKAIPDKGLDESPADVVYQS---VSPC-KLQTDTENsNFSNGRSFLPEG 645
gi 847098188   699 HRKGTIIRPQSASEASKIVRSQGKIMMPRPPPRPASGKVYNPTVANGSSQTqksDSPH-GGINVVPPsNPVVAKDAIPFQ 777
gi 902887924   795 NRRGTLVQPQSATEANTIPAARGRVLVPYPPSAPTTGNTSDKTMVSLGFQ----PQPSsSLQAATTNgNYFNERHVLLAD 870
gi 532086935   775 NRKGTVIQPRSAGKANTFLQTQGKFIIPHPPPKPTSNIRSGKNIHVSECQS---IITE-NSQNIITY-NCFNSKCMLPTE 849
gi 513019122   774 KGKGPIIQPQSASKANAFIQAQGKLIIPHPPPKPVSNIRSSKNVQVSQCQS---VMPQ-NSRNIITH-DCFNSKYVLPTE 848
gi 564309548   754 NRKPTVSQPQSSGKANTLAQTQGKLIIPHPPSKPPTNIKGGKNMQASPCQS---AIPE-YSQNVVTQ----STASVLPTE 825
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   848 HSLNQWNQESSSPLSNA-C-SDLVTVIPSLPS--YCSSECQTFAKINHSng-tQAVARQDATLY-C-------TQRS--- 911
gi 1018971876 1136 HMVSLGIQESGPSLWNNtCtSDLATVMPFRPS--SSISEGKILAKTNHP----TTSALQE--------------HDS--- 1192
gi 395520423   862 SSFSQISQESNPSFWNT-NsSDLVTSMPSLPS--YRASECQISAKINHSmkstQMIAQKDGSLI-C-------AQRS--- 927
gi 1023003151  861 NIFVHLSQENSPSLWNS-NnSEFVTQMPSLPS--YRTSDCQTSAKVNYTmkstQMIAQQDCSSI---------FTRS--- 925
gi 1033396553  646 QDVSRNNTGDALPSTNA-YrTHAATMRPS-----YSVFTYGPLTKTKVItnaaPSIVRSNS----F-------PKRT--- 705
gi 847098188   778 G--------SAPPA------ANVLATHP------YNLSAWEPNTKSVMSltseRVLALQDSLPV-S-------TKRY--- 826
gi 902887924   871 QTLTRRTRAHRESIT---CnSDLATPCCSTSRyePLAKK-TCSVNSGQTsa------cQDRSVTcTersvnaeNGLHldh 940
gi 532086935   850 HNLNQWNQESSPLLSDP-R-SDLVTVITSLPS--YYSSECQTLAKTNHSnd-tQMVTQQDGTLY-C-------TQRS--- 913
gi 513019122   849 HSFNHWNQESSPPLPDA-C-SDLVTVIPALPS--YYSSKCQTLAKTNHSds-tQMIAQQNGTLY-C-------TQRT--- 912
gi 564309548   826 YHLNQGTQESSLSFPDT-C-SNLPAVSPALPT--PCSSECQSSAKVns----nGTAFQKDGAVY-C-------TQRS--- 886
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   912 -PVCEESYPSV--TLRTAEEESVPLWKRGPNVLHQNKRAT---------------------------------------G 949
gi 1018971876 1193 -PVYEESCPKL--DHTPTEDEIALLWKGVHSALAQNENIAgdlqqgdeahy-----------------snsyltdlpasE 1252
gi 395520423   928 -PLCEENSHSL----KPIEEKIGFQWKEEHSAIGQNENAA---------------------------------------D 963
gi 1023003151  926 -PLYEENSHSL----KPIEEKIGIQWKGEHSALGQNEKTT---------------------------------------D 961
gi 1033396553  706 -PVYSENVLHL--DRIPTDEEITVLWQGVHHALAQKDVTA---------------------------------------G 743
gi 847098188   827 -PVYGENGIRL--DHTPTDDEIAVLWQGVRTALTHKHSGT---------------------------------------G 864
gi 902887924   941 iPTAEKTRSAWkgLRAALAPKDSAAGAIQHHVSHYNNSHItkwqpfkapvscitagensqktiikpssrmnelfsfsanS 1020
gi 532086935   914 -PVCEESPQSV--TLRTTEEESAPLWKRGNNILSQNERAT---------------------------------------D 951
gi 513019122   913 -PVFEESYQSV--TLKTTEKESIPSWKKRNTILHQNKRAS---------------------------------------D 950
gi 564309548   887 -PVCEESYQSL--IHRNTEEESILPWRRRING-RQNERTT---------------------------------------D 923
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   950 ------------------------------------------------S-TVMRRK-------RIA---ETKRRNILEQK 970
gi 1018971876 1253 ------------------------------------------------P-SLSRVNihggttlKNLkfnSTRNGTFSSSS 1283
gi 395520423   964 ------------------------------------------------S-TSARRK-------INLesnENKQRALLEQR 987
gi 1023003151  962 ------------------------------------------------S-TSIRRK-------MNLesnDNKPKTLLEQR 985
gi 1033396553  744 dsqhnstngdvpptrpnvshitidggilsgnikssfrsnaifaskpstSvAFARRK-------QMNennEYKRKALLEQR 816
gi 847098188   865 tfqpgdqrpsmqpartnlshviidggtc---------------------------------------------------- 892
gi 902887924  1021 ------------------------------------------------VvPVTRQK-------QIFdncEHTHRTFSEQR 1045
gi 532086935   952 ------------------------------------------------S-TVRRRK-------QI----ENKRRSPLEQK 971
gi 513019122   951 ------------------------------------------------S-TV-RRK-------LLI---ENKQRSLSDQK 970
gi 564309548   924 ------------------------------------------------S-TVTRRK-------QIV---ENKWKKLLEQK 944
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439319   971 RQNPGSVGQKYSEQI--------------------------NNFGQSVLLS----SSEPKQTTRGTSYIEE----VSDST 1016
gi 1018971876 1284 SDSTVTRRKQNLDSGdnklrgfaeqrretssskgkkfsdrgQNSEHPVKPSplhcAFEPVQTSRVISNAEE----VSEST 1359
gi 395520423   988 RQVSNSTRQKCIEQP--------------------------QNIIHPIQLS----SSEPVQSLSGISHPLE----VSEST 1033
gi 1023003151  986 RQLSNSIRQKPFEQP--------------------------QSIIHPLQLS----TSEPVQSLSGISHTEE----VSEST 1031
gi 1033396553  817 RQMTASARQK----A--------------------------TGVGQNI-AP----VVKKVQSQLAYEPIQSnsneVSDST 861
gi 847098188       --------------------------------------------------------------------------------
gi 902887924  1046 RQIVASKKTS-THHT--------------------------QNSLHAVQLSpiqsAFDPAQSMNNTYKSEE----VSEST 1094
gi 532086935   972 RKNPGSVGQKYSEQI--------------------------NNFGQSAQLS----SNEPKLTTRGTSNDGE----VSDST 1017
gi 513019122   971 RKIPGSVAQKYREQM--------------------------SNFGQSVHLS----SSEPKQTTRGTSNTEE----VSEST 1016
gi 564309548   945 RKTSGSVGIKHTEQI--------------------------THFGQNVPPS----TSEPIQATRGV-KSEE----VSDST 989
                         1210      1220      1230      1240      1250      1260
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 296439319  1017 SEFLMAENLVKASVPEDEILTVLNSKQIQKSNLPLNKTQQFNICTLSAEEQKILESLNDLSERLH 1081
gi 1018971876 1360 AQFLLAENLVKSSAPEEEILIAMETVQPQKPTTTLNKTRQSNINALSFEEQKILQSLECLNQRLQ 1424
gi 395520423  1034 AQFLMAENLVKSSVPEDTILTAMKSTQPYKPTLPLHKTQRLNIGALSFEEQKIIESLNHLNQRLH 1098
gi 1023003151 1032 AQFLMAENLVKSSLSEDKILTAMKPM-PYKSTLPLHKTQRLNIGALSFEEQKILESLNHLNQRLH 1095
gi 1033396553  862 TQFLLAENLANLSATESEILSGLDVAQAHKQTVVLNRPPRQGMSALSFEEHQVLQSLDRLNQRLQ 926
gi 847098188       -----------------------------------------------------------------
gi 902887924  1095 AQFLMAEKLASTPAAEDEILAAMEGVQPARQPFLLNRAPCLGMSALSVEEEKIFQSLDRLNQRLQ 1159
gi 532086935  1018 SEFLTAENLVKASVPEDEILTVMNNKQLQKSNLNLSKTQQFNICTLSAEEQKILQSLNHLNGRLr 1082
gi 513019122  1017 SEFLMAENLVKASVPEDEILTVLNNKQLQKSNLALNNAQQFNTCALSAEEQRILQSLDHLNERLH 1081
gi 564309548   990 SEVLVAENLMNSSLPEDEILTGINSKQLQKPNLSQTST----ICALSAEEQKILQSLHHLDERLY 1050
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap