Conserved Protein Domain Family
TSKS

?
pfam15358: TSKS 
Testis-specific serine kinase substrate
TSKS, testis-specific serine kinase substrate, is expressed in the testis and is downregulated in cancerous testicular tissue, in comparison with adjacent normal tissue. TSKS expression is very low to undetectable in seminoma, teratocarcinoma, embryonal, and Leydig cell tumors, while high in testicular tissue adjacent to tumors which contain pre-malignant carcinoma in situ. Recently it has been shown in human testis to be localized to the equatorial segment of ejaculated human sperm. The finding of a TSKS family member in mature sperm suggests that this family of kinases might play a role in sperm function. TSKS is localized during spermiogenesis to the centrioles of post-meiotic spermatids, where it reaches its greatest concentration during the period of flagellogenesis.
Statistics
?
PSSM-Id: 317725
View PSSM: pfam15358
Aligned: 3 rows
Threshold Bit Score: 831.586
Threshold Setting Gi: 637316202
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023014676  26 ENRTPLGPEDPGAGSGPRKGDRQAKEGCVFYGVEPRMSHEPMQwcLNLKRSSACTNVSLLNLAAVELPDSARIETTTDE- 104
gi 637316202   31 CSRPHGSKEQLGSKPSGTKAFPKKKKAVSFHGVEPHLASENSK--LNLKRSSACTNVSLLNLTDGERDDSTTENESTDDg 108
gi 301764939   26 ESRSQLVPEAPGGVTTPAKGITKKKKAVSFHGVEPRMSHEPMHwcLNLKRSSACTNVSLLNLAAMEPTDTSGTDSTTED- 104
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023014676 105 LPALPASGTSSTPalnLPASAPS--WA--PDDPDIADLLNGVNSGLLRAKDSITSLKEKTTRVNQHVQSLQSECSVLSEN 180
gi 637316202  109 SPPGGAAGERSAP---LPPIKSV--WSeyDDDDDTSSQQEVSNSGLLRAKDSITSLKERTSKVNRHVQNLQSECTVLCEN 183
gi 301764939  105 ------SGPLVLP---VPPASPTppWA--SDDPDITEILSGVNSGLVRAKDSITSLKEKTTRVNQHVQTLQSECSVLSEN 173
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023014676 181 LERRRQEAEELEGYCCQLKENCRKVTRSVEDAEIKTNVLKQNSALLEEKLRFLQQQLQDEPPRRQESDLPELEQQLEA-- 258
gi 637316202  184 LERRRQEAEDLEEYCTQLKDCCRKVTKSVEDAEVKTNVLKKTSVILEEKLRFLQRQVQVEDLSRQGREWQELEQRMASgi 263
gi 301764939  174 LERRRQEAEELEGYCSQLKENCRKVTRSVEDAEIKTNVLKQNSALLEEKLRYLQRQLQDETPRRQEAELQELEQKLDAgl 253
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023014676 259 ----RNcpptrwclpCPHpRPLKKTIRPPsePDPQADpptepqpepqpepelepepapvsSP---TPmphtgsptelsgp 331
gi 637316202  264 skqlLD---------LVS-NATAIALRPS--NSEEGE-----------------------LP---PP------------- 292
gi 301764939  254 srhgLG---------PTA-QSPGCCGPPG--SPNEPP-----------------------RPrsmAP------------- 285
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023014676 332 rllvnpgdgpegqgqSEG-------LGLAQVQSQSRTGES---GELELQKVTAG---------LEELRREVSSLTARWYQ 392
gi 637316202  293 ---------------TAAilasinnLRVALENGHMRAGLG---DEVSIDGKSNTastlaciplLEEIRKCVLELSGQSQR 354
gi 301764939  286 ---------------G-G-------WGMG-----PRAGEGpivSEQEMQKVSAG---------LEELRREVSSLTARWHQ 328
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023014676 393 EEGAVQEALRLLGGLGGRLDGFLGQWERAQREQAQTARGLQElrgRADELCTMVERSAVSVASLRGELEGLGPVKPVLEE 472
gi 637316202  355 EALTQKEVLRLLAQLGVRLEGLIPQWERTQVEHSQALRMLRE---ELDEVSATVKRTSVSLTQLRADLDGVRQVKPLLEE 431
gi 301764939  329 EEGAVQEALRLLGGLGGRLDGFLGQWERAQREQAQAARGLQElrgRADELCTMVERSAVSVASLRSDLEGLGPVKPILEE 408
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023014676 473 LGRQLSSARrgselsmSLDRP--G--SCTRCGSQGqQLSSETLQQLLERALTPLVDEVKQRGLAP-ACPSCQRLHKKILE 547
gi 637316202  432 VSRHLSVLK-------PLETPerQtvSCARCSSYS-FVNTESLRQMVEQAVAPILEELKQRTPPPgTCPSCQLLQKKIMD 503
gi 301764939  409 LGRQFQSSRrgsdlsmNLDRPpqG--SCGRCASQGpQLSTESLQQLLERALTPLVDEVKQRGLAP-ACPSCQRLHKKILE 485
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1023014676 548 LERQALAKHVRAEALSSTLRLAQDEALRAKNL----LLTDKmkpeEKVAALDYLHLKMCSLHDQLSSLPLEGSATGLGGG 623
gi 637316202  504 LEQSALDIHARAEVLSSNVRLAHDEALRANYLeqarIGTDK----DKSSSLDYLQNKQSSLNSQLVLVSQEGMPQSPAVS 579
gi 301764939  486 LERQALAKHVRAEALSSTLRLAQDEALRAKNL----LLTDKmkpeEKVATVDYLHLKMCSLHDQLSNLPLEGSTGTMGGG 561
                         650
                  ....*....|....*.
gi 1023014676 624 SSGGAPPKRGGPAPEQ 639
gi 637316202  580 LAANVALTKRSSCPGE 595
gi 301764939  562 SGGGAPPKRGGPTPEQ 577
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap