Conserved Protein Domain Family
Apelin

?
pfam15360: Apelin 
APJ endogenous ligand
Apelin is among the most potent stimulators of cardiac contractility known. The apelin-APJ signaling pathway is an important novel mediator of cardiovascular control. Apelin is an adipokine secreted by adipocytes where it is co-expressed with apelin receptor (APJ) in adipocytes. It suppresses adipogenesis through MAPK kinase/ERK dependent pathways and prevents lipid droplet fragmentation, thereby inhibiting basal lipolysis through AMP kinase dependent enhancement of perilipin expression. It also inhibits hormone-stimulated acute lipolysis through decreasing perilipin phosphorylation. Apelin induces a decrease of free fatty acid release via its dual inhibition on adipogenesis and lipolysis. As a vaso-active and vascular cell growth-regulating peptide Apelin is a target of the BMP pathway, the TGF-beta/bone morphogenic protein (BMP) system - a major pathway for angiogenesis.
Statistics
?
PSSM-Id: 317727
View PSSM: pfam15360
Aligned: 8 rows
Threshold Bit Score: 51.7199
Threshold Setting Gi: 941779987
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 20137196    23 VPLMLPPDGKGLEEg-NMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF 77
gi 284413797   23 APLAEGSDRNDEEQ--NIRTLVNPKMVRNPAPQRQANWRKIRRQRPRLSHKGPMPF 76
gi 941779987   23 GPMASTEHGRGLEEaaTVRKMAQQNPVRGGQTHRPA--KR-RRPRPRLSHKGPMPF 75
gi 260763937   23 GPMASTEHSKEIEEvgSMRTPLRQNPARAGRSQRPAGWRR-RRPRPRLSHKGPMPF 77
gi 972981967   23 GPLASTEQSKDMEEggSVRKLVQHSAARGGQSHRPAGWKR-RRPRPRLSHKGPMPF 77
gi 926728251   43 GPLLQTSDGKEMEEg-TIRYLVQPRGARSGPGPWQGGRRKFRRQRPRLSHKGPMPF 97
gi 752400486   88 GPLLQPSDGTWLEEg-SVHHLMQPKGSRNRPGPWQGGRRKFRRQRPRLSHKSPMPF 142
gi 1016698704  31 GPLLQPSARKGLEEg-NVRHLVQPRGSRNGPGPWQGGRKKFRRQRPRLSHKGPMPF 85
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap