Conserved Protein Domain Family
Enamelin

?
pfam15362: Enamelin 
Enamelin
ENAMELIN is involved in the mineralisation and structural organisation of enamel. It is necessary for the extension of enamel during the secretory stage of dental enamel formation. The proteins are expressed in teeth, particularly in odontoblasts, ameloblasts and cementoblasts.
Statistics
?
PSSM-Id: 317729
View PSSM: pfam15362
Aligned: 16 rows
Threshold Bit Score: 841.413
Threshold Setting Gi: 609876762
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    213 PYYSEEMFEQDFEKPKekdppktETPATEPSVNTTvpETNSTQPNapnpR----GNDTSPTGTSGQGPNPrsnPTGQNG- 287
gi 1023016730  235 PYYSEEMFEQDFEKPKeedppkvESTTAAPPTNSTvpETNSTQATvpvsGgsqgGNETSTTGNEAEVQNP--------Gi 306
gi 395541911   222 PYYSEEMFEQDFEKPKeedppkvESTTSAPPANTTvlENNSTQPTipspGgsqgGNDTSPTGNEAQAQNPgnnQGVYPGv 301
gi 255928802     3 PYYSEEMFEQDFEKPKekdppkaESPATEPTVNSTapETNSTQANvpgpGgskgGNDTTPTGNS-QGPNPgnnPTAQNGi 81
gi 347667808     2 PYYSEEI-E-DYEKPKeedppkpEDPPSEPSANSTvpETNSTQPgg------qgKNDTSPTLNNVPGLNTgnnPTAQNGi 73
gi 347667816     2 PYYSEEMFE-DYEKPKeedppkpEDPPSEPSANSTvpETNSTQLTnq------gKNDTGPTLNSIPGLNTgnnPTVQNGi 74
gi 532095372   211 PYYSEEMFD-DIEKPKekdppkaESPPAEPSANSTvtETNSTQPNp---GrsqgGNETFSIGNNAPVPNTgsnPTAQNGv 286
gi 291401655   209 PYYSEEMYD-DIEKPKeedppkaESPATETSANATvnETNSTQPNa---GgsqgGNDTSPVGNGAPGQNTgsnPTAQNGv 284
gi 332233523    59 PYYSEEMFEQDFEKPKeedppkaESPGTEPTVNSTvtETNSTQPNp---KgsqgGNDTSPTGNSTPGLNTgnnPPAQNGi 135
gi 395857228   215 PYYSEEMFEQDFEKPKeedppkaESPGTEPTANTTatGTNSTQPSp---RgspgGNDTNPAGNGGPGPSTggsPATPNGv 291
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    288 ---PAVNVSGQGVPRSqspwGPRQTIIHENYPNPNIRGFPARRQWRPPGPAMGHRRNGpfYRNQQIQrgprwnSFTLEGK 364
gi 1023016730  307 nlaPAVNVSGQDGPGSqvppGPYQPTILENSPNPNLRGFPISRQWSQTSFPVGPRLMGpfYRNYPNQrsyqwpSLAYVSK 386
gi 395541911   302 nlaPSVNVSSYDVPGSqipqVLNQPNVFENSPNPNFRSFPVNRQWSQTGLPLGPRINVpfYRNYPNQrifpwhNLAYVSK 381
gi 255928802    82 s-pPTVNVSNQGVARSqipwRQSHPNIHENYPHPSVRGFPTGRQWRPTGTAMGHRQNGpfYRNQQVQrgarwnSFTLEGK 160
gi 347667808    74 fplPRVNFSGQVIPRSqipwKPSQPKIYEIYPNPNMRNSPSGRQSNPTGTATGQRQSGsfYQSQPGQrgq-gnSFAWEGK 152
gi 347667816    75 fplPTVNFSGQVIPGSqipwKPNQPNIYGSYPKPNIRNSPSGRQSNPTHTATGQRPPGpsYRNQPGQwdaqgnSFAWEGK 154
gi 532095372   287 fppPSVNVSGQGGPRSqipwKPSQPKIHEIYPNPNIRNPPTGRQWHPTGTAMGHRQYGplYRNQQVQrgprwnSLAWEGK 366
gi 291401655   285 npsPAVNTSGQGAPRSqfpwRPSQPNIYENYPNHNTRNFPSERQWHHTGTAVGHRPNGpfYRNQQVQrgtqwnSFAWESK 364
gi 332233523   136 gplPAVNASGQGGPGSqipwRPSQPNIRENHPNPNIRNFPSGRQWYLTGTVMGHRRNGhfYRNQQFQrgprwnSFAWQGK 215
gi 395857228   292 tppPAVNASGQGVPGSqspwRPSQPNIRENYPNPNVRRFPSGRQWYPTGTAMGHRQTGpfYRNQQFQrgprwnSFV---- 367
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    365 QAVRPGYPTYRRVYGSTARSNPPNYAGNSANLRRKPEGpnknpmvtnvappgpkhgtvdQNENIQNPREKQVSQKERTVV 444
gi 1023016730  387 QIVRPGNTAYQKVYPYISKSNSPNHVSNPANNRRKPQGptkqpeeingglagpklgtahKEEQIQNPKENSVTQRERITF 466
gi 395541911   382 QIARPGNTAYRKVYPVIPKSNSPNQVSNAANNRKKPQSptknpeetnggsadpkhdtvhRDEQTQNPKENPVTEKERTTF 461
gi 255928802   161 QAARPGNPAYRKAYPSISRGNYLNHAGNPANFRRKPQWpnkypvganvaplgtkhstagRSEKIQNPREKTLGQKERVVV 240
gi 347667808   153 QAARPRNPTYGKAYTPTSRVNYPNYAGNPANFRRKPQGpnkpfvgtsvtplspkqgtvgHNEKIQNPKGKSLGQKERTVT 232
gi 347667816   155 QAAGPKNPTYHKAYTPTSRXNYPSYAGNPANFRRKLQGpnkpfvgtnvtpmspkqgtigRNEKIQNPKEKSLGQKESTIN 234
gi 532095372   367 QATRPGNPTYRKAYPPTSRVNYPNYAGNPANFRRKPQApnkhlmgtnviplgpkqatvgRNEKIQNPQEKSLGQKDRMIS 446
gi 291401655   365 QATRPENPTYRKTFHSTTRGYYTNYAGNPANFRRRPQGpnknvigtnvaslgpkqgsvgHNEKVQNPKEKSIGQKERTVV 444
gi 332233523   216 QVAHPGNPVYHKAYPSTSRGNYPNYAGNPANLRRKPQGpnkhpvgtnvaplgpkhgpvvHNEKIQNPREKPLGPKEQIIV 295
gi 395857228   368 QVARAGNPTYHKAYPSTSRGNYPNYSGNPANLRRKPQElnkhplgastaplgpkpstvsPSEKVQNPKEKPLGQKERIVV 447
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    445 PTRDPSGPWRNSQDYGINKSnyKLPQPEDNMLVPNFNSIdQRENSYYPRGESKRAPNSDGQTQTQIIPKGIVLEPRRIPY 524
gi 1023016730  467 PTRDPTSTWRNSQGYETNKSnyKLTPPQGSPSVPSVNSVdQPEN-YYPRVDSRRFPAS---IQASNFPKGIVSEPRKGPS 542
gi 395541911   462 PTRIPTSTWRNSQGYETNKSnyKLPPPEGNPPIPSVNSVdQHENSYYPRVDS-RFPAG---IQIPNFPKGIISEPRKDPS 537
gi 255928802   241 PTRDPPGPWKNSQDYGLNKSnyKLPHSEGNIQVPSFNSInQRENSYYPRGDPRTVQNSDGQTHNKYLPKGIVLEPRRIPY 320
gi 347667808   233 PTKDTSGSWRNSQHYGVNKPnlGWPHPEGNMLGPNFNSAnQHENSYYSRGGSRGVPNSNAQTQSQNFPKGVALETKRIPY 312
gi 347667816   235 PTKGMSGSWRNSQYPGVNKPnyGWPHPEDNMLGPNFNSVnQYENSYYPRGEVIKVPSSNAKTQSQNFPKRVALEPKRIPY 314
gi 532095372   447 PTKDTAGVWKTSQHYGVNKPnyKSPRPEDNMLGPNFNSInQRENSYFPRGDSRKAPSSDVQTQSQNLPKGIALEPRRIPY 526
gi 291401655   445 PTKDTTGPWKNSQSYGVNKRyyKLPWSEGNIQGPNFNSIgQQENSYNPRGDSRRIPNSGVQIQSQNLPKGIVLQPKRTPY 524
gi 332233523   296 PTKNPTSSWRNSQQYEVNKSnyKLPHSEGYMPVPNFNSVdQHENSYYPRGDSRKVPNSDGQTQSQNLPKGIVLWSRRIPY 375
gi 395857228   448 PTKDPTGPWRKSQQYGVNKSnyKLPHPERNTPVPNFNSIdQREN-YHQIGDSTRLPNSNGQTQSQNLPKGIVLEPRRVPY 526
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    525 ESETNQPELKHsayQP-VYTEGipspAKEHFPAGRNTWNQQEISPPFKEDPGRQEEHL---PHLSHGSRVHVYYPDYNPY 600
gi 1023016730  543 DSEINPPEIKHgthQ----TDEgpypPKESFFLRSNTWNLQKGSPIFEDEPTKQEGSL---LYPALGARENVPYPEYVPY 615
gi 395541911   538 DAETNPPEMKQgthQP-PYAEEdpylPREPFFPAANTWNPQQGAPVFEDEPLRQEGPL---LYPAFGVRGNVPYPEYIPY 613
gi 255928802   321 ESQTNRPELKHgtyHP-VYPEEipspAREHFPAGRNHWNNQELSPTLEEDPGRQEEPL---PHPSHGSRGSVFYSEYNPY 396
gi 347667808   313 ETQTKQPELKHsthQP-IYPEVipspKSEHFPAGRNTWSHQKIPPSFKEDPGKQEEHL---PHLSPGSWGNVFYHEYNSY 388
gi 347667816   315 ESQTMQPELKHsthQP-IYPEVipspKREHFPAGRNTWSHHEIPPPFKEDPGKQDKHL---PHVSPGSQDSVFYHKYNSF 390
gi 532095372   527 ESETNQPELKHstqQP-VYPEEipstTREHFPTGRNTWSNKEIPPYFKEDPGRQEEHL---PQPSQGSRGSVFYHEYNPY 602
gi 291401655   525 EPQTNQPELKHrtyQP-AYPKEiptsTREHFPTGRNTWNHQEISPRFKEDPRWQAKRLppsPPPSHGSRGSVFFQKYSPY 603
gi 332233523   376 ESETNQPELKHssyQPaVYPEEipspAKEHFPAGRNTWDHQEISPPFKEDPGRQEEHL---PHPSDGSRGSVFYPEYNPY 452
gi 395857228   527 ESETNQPELKHstyQP-VYPEEipspAREHFPAGKNTWNHQEISPPFKEDPVRQEEHL---PYPSHGTRGHVFYPEYNSY 602
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    601 DPRenspylrsnTWYERDDSPNTM---GQPENPHYPMNTP-DPKETIPYNEEdpIDPTgDEHFPGQSRWDMEELSFKEDp 676
gi 1023016730  616 DPQrsslyargnMWDEGDEFPGTFrpaGQPGNPLHSLNSPsGQRHRSTDNEEdpIDPTgDEFYRGPDAGG-KESNFKGSq 694
gi 395541911   614 DPRgnspyargsMWDERDDFPGTFrptGKAGNPSYSPNTPpSQRRPSTNNEEdpIDQTgDEIYRRPNAWG-KESNFKESq 692
gi 255928802   397 DPRenspylrsnTWDERGDSLNTM---RQPENPLYPVNTP-NQKETVPYDEEdpIDPTgDEHFPGPGRWAKEESSFKVSp 472
gi 347667808   389 YPRenspyiggnTWDERVDSPNTM---GQPKHPQYPLKTA-DQKETVHYNEEdpPDPTgDEPFPGQSRWGEEELSFNGRp 464
gi 347667816   391 YTRenspytgsnTWEKRADSPKT-----QAKTPQYPLKNT-DQKETIQYNEKdpSDPTrHGPFPGLSRWGEEVLSFNERp 464
gi 532095372   603 YPRenlpyirsnIWDERIDSPNTI---RQPENPRYSMNTL-VQKETVHYNEEdpRDPTgDESFPARSKWGEEELSFKGSp 678
gi 291401655   604 DPRenppyrrsnMWGEIVDPPSTM---RQPENPKYPMNTP-DQKET--YNEEdpIDPTgDEIFPGQSTWGEEELSFKRDp 677
gi 332233523   453 DPRenspyfrsnTWHERDDSPNTM---GQKESPLYPINTP-DQKETVPYNEEdpTDPTgDEVFPGQNRWG-EELSFKGGp 527
gi 395857228   603 TPQenspylrssVWDEREDSPNTM---GQQENPLYPINTP-DQKGTVPYNEEdpIDPTgDEPFPGQNRWG-EDLSFKEGp 677
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    677 tvRHYEGEQYT---SNQPKEYLPYSLDNPSKPREDFLYGEFYPWNPEENFPSYNTAPTVSspVESRG-YYANNAVGQEES 752
gi 1023016730  695 -vRYRERYPYApshPSKPKEYPQHSTDNLERQR-NPSYGEYYPWH----FPPYNFAPPLTppRENSGyYYPPNALEQEES 768
gi 395541911   693 -vRYREKYLYApgrPSEPKDYPQHSTDNLLKQR-NSPYGEFYPWHP-EYIPSYNMAPPLTppGENNGyYYPANAFEQEER 769
gi 255928802   473 tvRHYEGQQYA---SNQPKEYLPYSLDNPSKPKEDFPYGEFYHWGPDENFPPYNTAPTIPppVESRG-YFVDNADEREES 548
gi 347667808   465 tsRHYDGGKYA---LNQPKEYLPYSLDNPSKPREDSPYSEFYPWTLDETFPLYRPGPTTSppMDSRG-HYVNNAIQQEES 540
gi 347667816   465 mgRHNDGXQYA---SNQPKEYLPYPLDNPSKPREESPYTDFYPWSLDETFPSYSPGPTVSppGKNRG-HQVNNAMRQEGS 540
gi 532095372   679 tvRLYEGEQYA---SNQPKQYLPSSLDNPSKPREDFPYSEFYPWSPEETFPSYNPGPTISppVENRG-YYGNNAIGEEES 754
gi 291401655   678 tvRQYGGGQYA---LNQPKEIFPYPADNPSKPKEDFPYNDFYPWSPDENFPSYNTGPTVTppMQNKG-YYTTSAAEQEES 753
gi 332233523   528 tvRHYEGEQYT---SNQPKEYLPYSLDNPSKPREDFYYSEFYPWSPDENLPSYNTAPTMSppIESRG-YYVNNAAGPEES 603
gi 395857228   678 ttRHYEGERYT---SNQPKEYLPYSLDNPPKPREDFPYSELYPWSPDENFPPYNTAPTGSppIESRG-YYANSAAGQEEG 753
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    753 TmFPSWSSWDPRIQAQGQKEGRpYLNRNFWdqSTNlyktPTSSPHQKENQPYSNNSPAGLQKNPTWHEGENLNYG-MQIT 831
gi 1023016730  769 TpSPSWGSWDQKNYVPAKKGRIpYYNRYFWdqATNlhksAASALEQREHQPHSSSFPAGLRGSLTYQETENLNYDsVHNN 848
gi 395541911   770 E------SWDQKNYVPAQKGRVpYYSRNFWglATSlqksTANSLSQREDQPLSSNFPVGLRGNPTYQEAESHNYGsEQIN 843
gi 255928802   549 TlFPSWNSWDHRIQAQGPNERGpYFNRNFWdqTTNlhkaPASLPDYKESQPYSSNSPAGLQKNPTWHDSENLNYG-MQIT 627
gi 347667808   541 TlFPSWNSWDHKIKVPGQQESEpYFNRNYWdqATNlq--kvSLPNQKENYPYSSNPPAGLQKNPTWHEGEKLNYD-MQMT 617
gi 347667816   541 AlFPSPNSWDQGIQVQGQQESEpQFHRNYWdqATNlh--evGPPNQRXNYPYPSQPHVGLQKTPTWQEGKNLNYD-MQMT 617
gi 532095372   755 TfFPSWNSWDHRIQPQGQKEREsYFNRNFWdqATNsq--kaSLPDQKQNNPYSSNTPAGLQKNPTWQEGQNLNYD-MQIT 831
gi 291401655   754 TlFPSWNSWDYSFQAQEEKEKQpYYNRNYWdqATNlqqtPASIPDLKETQLYYTSSPAGLQKNPVWHEDENLNYG-MQIT 832
gi 332233523   604 TlFPSRNSWDHRIQAQGQKERRpYFNRNIWdqATHlqkaPARPPDQKGNQPYSSNTPAGLQKNPIWHEGENVNYG-MQIT 682
gi 395857228   754 TlFPSWNSWDHRIQAQGQKERGpYFSRNFWdrAVNldkaPASPPDQKEKHPYSNNSPAGLQKNPVWREGDSWNYG-MQIT 832
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    832 RLNSPERDHLAFPDLIPPDYPGGQKESHVFhlsq-rgpCCAGGSMWPKNNPLALQDYTQSFGLAPGENPDTSiGYAEDSH 910
gi 1023016730  849 RINTPEKGQFPVTDSVIQNNLIYQGEVYSYspasqrspCCAGESPGPRESPLISLDYSPPFGLVSGDDGERNpPTTEGIH 928
gi 395541911   844 RVNLSDKGQLAVTESVIPNSPVNQEEADSYppasqrnpCCASDPAGFKDIPFVPLDYFPPFGLVS--EGERNsFYTESSH 921
gi 255928802   628 RLNSPEGDHLAFPDLIPQSYPADQEEANLFhlsq-rgpCCAGGPTGPKDNPLALQDYTPSFGLAPGENQDTSpLYTEGSH 706
gi 347667808   618 RLNSPERQHLAFLDFIPQSYLSEQTEAHLFhqsp-qssCCVGSSTGPNENPLALQVYTPSYGNTPEENQNINpTYTESSH 696
gi 347667816   618 RLYSPERSHLAFPDVMPQSYPLGQTESHLFhpnp-sssCCVGGAAGPHKNPLALQDYTPSYGLAPGENHNTNpTYTESSH 696
gi 532095372   832 SLNSPERQHLAFPDFIPQSYPSGQKEAHLFhhsp-rgsCCVSGSTGHKDNPLALQDYTSSYDLAPGENQATNpMYTESSL 910
gi 291401655   833 SLNSPDRDYLTYSDLITQNYPSSQKEIHLYhqsq-rgpCCTGGSTGPKDNPLSLQAYTSSYGLAPEEKQDTNpLYTESSH 911
gi 332233523   683 RTNYPEREHSSFPDFIPQSYPSGQKEAHLFhlsq-rgsCCAGSSTGPKDNPLALQDYTPSYGLAPGENQDTSpLYTEGSH 761
gi 395857228   833 RLNSPERKQVAFPDLIPQSYPSHQKEAHLVhlhh-rgpCCAGGPTGPKDDPLALQDYTPSYGLAPGEKQDASpLYTEGSH 911
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    911 IKYARQTVSPTSIvpgQRNSSEKILPGESQNPSPFKDDVSTLRRSTPCSvKSQLSQRGimplPEANSLQSKNTPCLTSDL 990
gi 1023016730  929 MKHARHIIYSTDIqpnQRNSSEKNLSEKGANPDPFRADTAMLKKSSPCSkRSPAGQTEsvpfSEADSLQA-NMPCRKSNL 1007
gi 395541911   922 TKHARHIIYPPGIqsnQRNSSEKYLPEKEENPDAFRDDSFTLKKNTPCSkRNEVEQTGsrvfSEADSLQA-NTPCFKSHL 1000
gi 255928802   707 TKHARHIISPTSIlpdPRNSSEKTLPGESQNPSPFRDDVSTLRRNAPCSiKNQLGQRGmmplPETSSLQL-NAPCLKSDL 785
gi 347667808   697 TKHARPIVSPANIlpgQRNSSEKKLPGESQSPSTFRDDVPTL-KNTPCSvNNQQGQVGirsfPKASFPQSKNTPCLKNDL 775
gi 347667816   697 TTHTRPNVSPTSIlpgQRNSSEKKLPGESTKPSTLRDNVSSL-KNAPCSaKTQQGTGGvrsfPKASAPQS-NTLCLSNDL 774
gi 532095372   911 TKHTRPIVSPTNIlpgQRNSSEKKLPGESQNTSPFREDVSTLRRNTPCSvKNQLDQTGmmssSETSSPQSKNIPCLKNDL 990
gi 291401655   912 TNNPSPIVSPTSIlpgQRNSSENRLPGEIQSPISFRDDVSTLRRNIPCSmKNQLSQLEi----mSNSPQSKNTPCLKNDL 987
gi 332233523   762 TKQTRHIISPTSIlpgQRNSSEKR---ESQNP--FRDDVSTLRRNTPCSvKNQLGQKGimpfPEASSLQSKNTPCLKNDL 836
gi 395857228   912 AKHARHVISPAGVlpdQRNSSEKRLPGESQSPSPVRDDVSILRRNTPCSsKNPVGQRGvvpfPEASSLQSKSTPCLKSDL 991
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 11386722    991 GGDGNNVLEQIFEGNQLNERTVDLTPEQLvfgtpdkePRPEGIPNE-MQGNESERQQQRQSSILQLPCFGSKLaNYHTSS 1069
gi 1023016730 1008 RGEGNNVLAKILGVNQFNARTSNLIPEELeap--eenLGPENIQSE-GGGSEGRVKQKGVPNIQKVPCLHSKLkDHLLSS 1084
gi 395541911  1001 RGDGNDVLTKIFGTGQFDERTNNLIPEELeap--kesPRPENIESE-GGGSEGRMKQKGVPIIQQVPCLHSKLeKHFPSS 1077
gi 255928802   786 GGDENNVKEQMFEDNQPNERTVDLIPEQLvigtpdedPTPEAIQSE-VLGNEGDRQPQRAPSILQLPCFG-KLaKHHFSG 863
gi 347667808   776 GGDGNNVLEQIFEGNHLNERTADLTPEQLvirtadegPKSEGIQNE-IQGKEGEQQQQRPPSVLQVPCFGSQLtKLQSSS 854
gi 347667816   775 GGDGNSVLEQIFEGNHLSERTVNLTPEQLfigtlbegLKPPGIQKE-MQGEEDDRPQQRPPSILQVPCFGSQLtQLHSSS 853
gi 532095372   991 GGDGNNILEQIFEGNQLNERSVALTPEQLvigtidegSKPEDIQNE-VQENEGERQQQRPPSILHVPCFGSKLaKLHSSS 1069
gi 291401655   988 GGDGNNIVKQMFEGNQLNERTVALTPEQLimgtpdegPRPKGIQSE-VQGNESEKQQQRPPRILHVPCFGSKLaDHHSVS 1066
gi 332233523   837 GGDGNNILEQILEDNQLSERTVDLTPEQLvigtpdegPNPEGIQSQ-VQENESERQQQRPSSILHLPCFGSKLaKHHSST 915
gi 395857228   992 GGDGSKVLEQTFEDNQLNGRTVGLIPEQLvigapdegPSPEGIQSEvVQGKEGERQQQRPPRILQLPCFGSKSaNHHSSS 1071
                          890       900       910       920
                   ....*....|....*....|....*....|....*....|....*.
gi 11386722   1070 IGTPSSLGRQDSFDGDPIMPTETP-NSLAglatgAQFQNINVDPLN 1114
gi 1023016730 1085 TGAPLGKRRPGLSTGEPAMVSAQPsSTLTgltarEQLGGTNIDPLV 1130
gi 395541911  1078 TGPPLDKRRPDLSDGEPEMVSAQPsSTLNglaarEQLSGTNIDPYI 1123
gi 255928802   864 TGTPSSNGRQGPFDGDPIIPTE-----LAevateAQFNSVDVNTLN 904
gi 347667808   855 IGTPSISGRQGPFDRDLTMPTQNP-NTFVglatgEPFRSINIDQVN 899
gi 347667816   854 TGTPSSSRRPGPSGGDLTKPTENP-NTFVgfatgEPFRSINADQLs 898
gi 532095372  1070 TGTPSSNGRQGQFDGDLTIPTENP-NTLLglateEPFKNINVDQLN 1114
gi 291401655  1067 TGTPSTSGKQDPTDGDLIMPTGNP-GTSVglatgEQFKHINVNSFN 1111
gi 332233523   916 TGTPSSSGRQSPFDRDSIMPTENP-NTLVelateEQFKSINVDPLD 960
gi 395857228  1072 PRTPSSNGRQGPFDGDQIMTTENP-DTLAelapgEQFRSVNVDPLD 1116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap