Conserved Protein Domain Family
DUF4601

?
pfam15373: DUF4601 
Domain of unknown function (DUF4601)
This protein family is a domain of unknown function, which is found in eukaryotes. In humans, the gene encoding this protein is found in the position, chromosome 19 open reading frame 45.
Statistics
?
PSSM-Id: 317740
View PSSM: pfam15373
Aligned: 8 rows
Threshold Bit Score: 766.313
Threshold Setting Gi: 586976651
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545220981   74 LFQQDPRWAGEERVSEAHCVFTPPp--PSERSGERELERARDRTLAMQASH-LVLHADARARTGLSTARADFRWPELPAR 150
gi 251823732   58 IFQREARWASQKHVSEMRRAFSPP---PTLQSQDELRERAIEHSQAMQISN-LHLHADMRPGLNLSIARTDYGWPELPPS 133
gi 532093243   75 fppHDARRAGPEQVSEMHREFTPRevqPP--------EETRERTLAMQSSS-LRMHAGERTGVSFSNARAAYGWPEQPAH 145
gi 348564884   63 LFQRDRRWKAEESVSEARRAFTPP------------AELEDPRARAMPRSScLSLYAGRGAGPVLSSARAAYGWPEVLAH 130
gi 395862434   63 LFHVDARWAGEEHVSEARRAF-PP---PPEQAWEQERELVRERTRAMQASS-VLMHADARAGSRLSNARAAYGWPELPAR 137
gi 1034129080  66 LFPMDPRWDREERVSEAHRAF-PP---PSTPPWELLQAQARERTLAMQASN-LHLHEDAHAGIGLSNAHAAYGWPELPAR 140
gi 982930603   89 LFQKDARWAGQERLSETRCAYEPP---PPMLLREQERELARERTLAMQASH-LHVHAEARARTGLSTARGDYGWPEPPER 164
gi 586976651   76 FFRQDTRAAGAELQSEAHRAFAPPapqPSAPSG------TRERTLATPATN-LRVYAPARSRTGLSTARADFGWPELPAR 148
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545220981  151 AREQIRGARLIFDRDSMPPGDRAKLRIPPTTYQELFPPHDA-RPQPCAPRRHLGGPNPLKWDHGRQdDGTSYQRQFQALP 229
gi 251823732  134 ARLDIRSARLLFDRDSMPSGDRKQLRMPLTSYQAHYPPYDAiTPQPCVPCSHLGGPNTLKWNYKGQ-KDTSYKKQFQALP 212
gi 532093243  146 ARELIRGARLIFDRDSLPQGDRDQLRVPPTTHQELYPPHDA-CLPPRAPCHHLGGPNTLKWGYKKQ-QGTSYRREFQALP 223
gi 348564884  131 AGERVGGARLIFDQDSVPPGDRDKLRIPPTTYRTLFPPHDA-CPQPRAHSRHLGGPNTLRWDYRRR-EEPSYKTQFQALP 208
gi 395862434  138 ARETIRGARLIFDRDSVPSGDRDQLRIPATTHQALFPPHDA-CPQARAPCSHLGGPNILTWDYRGQ-DGTSYQRQFQALP 215
gi 1034129080 141 TRERIRGARLIFDRDSLPPGDRDKLRIPPTTHQALFPPHDA-RPQPRAPSCHLGGPNTLKWDYTRQ-DGTSYQRQFQALP 218
gi 982930603  165 AREQIRGARLIFDRDSLPSGDPDKLRIPSTTYREFFPLHDL-CLKPREPACRLCGPNPLQWEHKRQdDSTSYQRQFQALP 243
gi 586976651  149 AREQIRGARLIFDRDSVPPGDRAKLRIPPTTYRALFPPHDA-CPRSRAPCSHFGGSNALQWDHRRQdDGTSYQRQFQALP 227
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545220981  230 GPPALMCKRAASSVELGNFKSASGPVCSEQKQAYGPQGLPSHRYDKAQASAHIHYVNIRPGDGLFHDRTTQAEHYYAREP 309
gi 251823732  213 SPPALMCKRASSSVNLGDSKVGYSPLCSLVKQTYTPQGLSPYRYDKVQAAAHIHQVNVGPGDRLFHDRTTMNDYFYSKEP 292
gi 532093243  224 GSPALMCRRASSSVQLGDCKLGYGLMSSDLKQTHRPQGLPPDRYDKAQAATHIHQVNIRPGDGLFHGRTTVTDHFYAREP 303
gi 348564884  209 GPPALMCKRAASSIHLGDCTIGYDPGCSELKRAHRPPGLPPDRYDKAQAAAHIHIVSIPPGDGLFHDRTTMSHHFYPRDP 288
gi 395862434  216 GPPALMCKRASSSVELGDCKIGYRPMCSEQKQAYRPQGLSPDRYEKAQAAAHIHYVNISPGDGLFHDRTTKSEHFYPQEP 295
gi 1034129080 219 GPPALRCKRASSRVELGDCKISYGSTCSEQKQAYRPQGLPEDRYDKAQAAAHIHCVNIRPGDGLFRDRTTKAEHFYAREP 298
gi 982930603  244 GPPALPCKRASSSIELGDFKIGYRPMCTEQKQAYGPPDLPPDRYDKAQASAHIHCVNIRPGDGLFHDRTTKGEHFYAREP 323
gi 586976651  228 GPPASMCKRASSSVELGDSKIGYGPVCSEQKQAYGPQGLPPDRYDKAQASAHIHYVNIRPGDGLFRDRTTEAEHFYPREP 307
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545220981  310 EPFILHHNQTPESHILEGNWCPGPGSLTTSMHFFYGQPPPATKPPCRHPPHEKLQSHVTLGEPSLLGRFFQTSMGRDYYP 389
gi 251823732  293 EPFVLHHDKTPESNILKGNWCPGPGSLHTSSKFFYGEPPPATQPPGRQVSHEKLKDHIILGDSKLLGNFFQTSMSSDYCP 372
gi 532093243  304 EPFVLHGDQTPKSHILKGNWHPGPGSLSTSMQFFHGQVPPSTQPPGRHMTHENLKSHVILGEEKLLGHFFQTTTGSHYCP 383
gi 348564884  289 EPFLLHHDQTPESHILKGNWCPGPGSLTTSMQDFYGQPLPETQPPSHCGADENLQSHMTLAEPKLLGRFFQTTMRSAYCA 368
gi 395862434  296 EPFVLHHDQTPESHILKGNWCPGPGSLDTFMRYFYGQPPPPTQPPSRHAAHKKLQSHVTLGDPKLLGRFFQTTMGSDYCP 375
gi 1034129080 299 EPFVLHHDQTPESHILKGNWCPGPGSLDTFMQHFYGQPPPPTQPPSRHVPHEKLQSHVTLGEPKLLKRFFKTTMGSDYCP 378
gi 982930603  324 EPFLLHHDQTPESHILEGNGCPGPGSLTTSTHFFYRQPLRTSEPASRHVPHETLQSHITLGEPSLLGQFFQTSMGTDYLP 403
gi 586976651  308 ERFVLHHDQTPASHILEGNRCPGPGSLTTSVHFFHGQPLPVNKPPSCHVPHEKLQSHVGLGESSLLGQFFQTSTGTDYCS 387
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 545220981  390 PG-MQHPQKAPNLHLKQSNLPQGTGELDFLTMNQKMLKPHRTAPASPTEEMFQRCKYSHMEPPLGRQRFFSTQHGDEFTF 468
gi 251823732  373 PT-TPIKQRTLKFSLLESNLPEGTGELDFFTTNQMMMKPHGIVRASITEDLLQKCKYSHIEPPLGRQRFFSTQNQDEYPF 451
gi 532093243  384 QH-VEGSQKIPSPQMTQSNLPKGTCEFDFLTMNQKMLKPHGRAKALVTEELLQKCKYSHLEPPLGGQRFLSTNYQVDFPF 462
gi 348564884  369 PE-RRQPQKAPNLHLMPSILQQDGGELEFLTTNQTMLKPHRIVGARMTEELLQRCKYSHVEFPLGRQRFFCTEYKDEFPC 447
gi 395862434  376 SE-MVEMPKASSLHLLQSKLLLGTSEFDFLTTNQKMMKPHGKARAPRTEEMLQRCKYSHMEPPLGRLCFFSTQYKDEFLH 454
gi 1034129080 379 SE-WRQVQKAPNLHLQQSNLPRGTGEFDFLTMNQKMLKPHRTPPAPVTEEMLQRCKYSHMEPPLGGLRFFSTQYKDEFPF 457
gi 982930603  404 PG-MPKPPKAPNLHLQRSNLPEGTGDLDFLTMNQKMLKPHGIAPASVTKELLQRCKYSHLEPPLGQQRFFSTLNKDEFTF 482
gi 586976651  388 PGtIQKPQRAPTLHLLRSNLPQGTGETDFLTMNQKMLKPHRTAPASVTEEMLQRCKYNHIEPPLGGQRFFSTQYEDEFAF 467
                         410       420       430       440
                  ....*....|....*....|....*....|....*....|....*..
gi 545220981  469 KYQGPAVLRWGNFQESHVPLGSPRQWGCWGEKVDPQAPQIPMYPCPS 515
gi 251823732  452 KYQGPLVQKLSSMHESHLPMGTPKYLGCWHEKADPRGPQIPMYPCLS 498
gi 532093243  463 KYQGPVVLKMMNFQESHVPLGTPRQPGCRHRKVDPQAPQMPMYPCPS 509
gi 348564884  448 KYQGPVVLRISNAQESSVPLGTPCQQSCPRRVVDPQAPQLPMYPCPS 494
gi 395862434  455 KYQGPAVLKLSKLQESSVPLGTLRQWGC-GEKTDPQAPQLSVYPCPS 500
gi 1034129080 458 KYQGPAALRLKNPQEGFVPLGTPHQRGC-REKIDPLVPQPPMYPCPS 503
gi 982930603  483 KYQGPAVLRWDDFQESHLPLGSLHQWGCRARKVDPRAPQTPIYPCPS 529
gi 586976651  468 KFQGPAVLRSANLQDSHVPLGSPRQWVCGAGKVDPQTPQPPTYPCPS 514
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap