Conserved Protein Domain Family
CCDC71L

?
pfam15374: CCDC71L 
Coiled-coil domain-containing protein 71L
The protein family, Coiled-coil domain-containing protein 71L, is a domain of unknown function, which is found in eukaryotes.
Statistics
?
PSSM-Id: 317741
View PSSM: pfam15374
Aligned: 12 rows
Threshold Bit Score: 453.515
Threshold Setting Gi: 972972942
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81902049     8 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKLQ 87
gi 612041225    8 VEEKAVHSWSRISSAGQKALEEALLVFNPMSKDLSDTEAQLVAFLQGLREEGYQPTILRSKDVYGYSSCTADPPSQTKHH 87
gi 149447973    5 gEEKAVHSWSRISSAGQKALEEALRVFNPMSKNLADTETQLVAFLQGLREEGYQPTVLGSKDVYGYSSCTADTPEQTKEP 84
gi 972972942    8 VEKKAVHSWSRITSAGQTALLEALRVFSPMSKDLLDTETQLVSFLQGLKDEGHKATVLKSKDVYGYESCTAETPSVEKMS 87
gi 987959303    7 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLREDGFQPTVLRSGDVYGYSSCTATPPSQTKLH 86
gi 823467528    8 EEEKAVHSWSRISSAGQKVLEEALRVFNPMSKDLSDTETQLVAFIQGLKEEGYQPTILRSKDVYGYSSCTAVTPSQTEEN 87
gi 565318638  100 VEEKAVHSWSRISSAGQKALEEALRVFNPMSKDLSDTETQLVAFLQGLKEEGYHPTILRSKDVYGYSSCTANAPGQTKGN 179
gi 637273060    8 EEEKAVHSWSRISSAGQKALEEALRVFNPMSKDLSDTETQLVAFLQGLREEGYQPTILRSKDVYGYSSCTARMPSQTKGS 87
gi 426340528    8 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTANPPSQTKLQ 87
gi 311268897    8 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTANPPSQTKLQ 87
gi 1032959071  32 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTANPPSQTKLQ 111
gi 514473788    8 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLNATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKLQ 87
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81902049    88 art--inPPATSL----PKTAVSVPAGRTTLLPVPLSGRLAKGSTAALAKH-ATTNLLLSSLKQSSASNSSGTTVGFPAH 160
gi 612041225   88 -------VGPSTQakplPSDVPRATSRSLLAVPGTILGRSSKVSSSPIIKT-SSTNLLLNSLKQSGSGGGKNSSVGFPTH 159
gi 149447973   85 arntsraAAGLSAppdaPSGTPVAAMAEMLAVPGAVSVSSSKVPPSPTSKT-SSPNLLLNSLKQTESDTSKTATASFPAN 163
gi 972972942   88 kpl--dtTGKVTKvlkpVKKRARKTVAKKKEINYALLSAAAKLVLKNQPKI-LLTNLSQESLKRTVAVLSKPSASTVHVV 164
gi 987959303   87 ara--piPATTSPpasaPRAAVRLPAGRATLLPMPLPGRLAKASTPALAKH-AATNLLLSSLKESSASHARDTAMGFPTH 163
gi 823467528   88 tqr---scASTTEptqsPARN---SVAKVAPLPTSIPVSSLKVSNQQVSKG-DSTNLLLSSLKRTGSGTSKAATVGFPTS 160
gi 565318638  180 ipdvsetAVPISEsakaPARNV-VTIEKVSAPLAGITVSSSKESAKPMSKSgNSTNLLLNSLKRTRSGTSKASAMSFPAN 258
gi 637273060   88 gqd-tstAAPISEsakvPARNM-GTMSKASSPLAGIIVSSSKGSARPLSKNnNATNLLLNSLKRTRSRTSKDSAVGFPAN 165
gi 426340528   88 ara--pnPTATSPpasaPRTAMRLPAGRATLLPMPLSGRLAKASTPALAKH-ATTNLLLSSLKQSSASHARGAAVGFPTH 164
gi 311268897   88 ara--pmPAATSPpasaPRTPMQLSAGQATLLPMPLSGRLAKASTPPLTKH-ATTNLLLNSLKQSSASHAQGAAVGFPTH 164
gi 1032959071 112 art--tnPSATSLpsraPQTAVSLPASQATLLPVPLSGRLAKGSTPALAKH-ATTNLLLSSLKQSNASHTSGTTVGFPAH 188
gi 514473788   88 ara--pnPTATSPpasaPQTAVHLPTGRATLLPMSLSGRLAKGSTPALTKH-TTTNLLLSSLKQSSASRTRGATMGFPTH 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81902049   161 LYPGVYPAMRLSVVLEALVPLKTP--CLDVKHGAqslqLSLAKSPLKVRKASG----NPKSKAPRKITS--------KGL 226
gi 612041225  160 MYPGVYPAMRLSVVLEALVPLKATasCLNSKYKP----LGISNSDLKLLKGSG----RSRQSAPNKTTN--------KGH 223
gi 149447973  164 TYPGVYPAMRVSVVLETLVPLKSTanCLESKYNPg--hLGIANADLKLVKASG----APRLSTLGK-TA--------KGP 228
gi 972972942  165 NSTKMQPCLKLT---KLTAPSGSPtaRLQIHSELgslgISVPNSNWAPKPTGT----SAQPLENSGKTS--------KGP 229
gi 987959303  164 LYPGVYPAMRLSVVLEALVPLKTPvpHLGAKHETqslqLSLADSPLKLREGPGk-----RLAVPRKVTS--------TGP 230
gi 823467528  161 MYPDVYPAMRLSVVLEALVPLKTAtsCLESKYTRg--rLGISPSDLKRLKTSS----PPRQFSSGKSTKit----egKGY 230
gi 565318638  259 MYPGVYPAMRLSVVVEALVPLKATasCLESKCKQg--hLEISPSDLKRLTAST----ASMQSSAVKATKippnqldpKGY 332
gi 637273060  166 MYPGVYPAMRLSVVLEALVPIKATasCLESKCKQg--hLGISSSDFKLLKAAS----GSRQSATIKATKlspnqldsKDY 239
gi 426340528  165 LYPGVYPAMRLSVVLEALVPLKTPmpCLGAKHKAqslqLSLADSPLKLRKSSGkgpgNPRPKATRKTTS--------KGP 236
gi 311268897  165 LYPGVYPAMRLSVVLEALVPLKTPipCLSAKHKAqsvqLSLADSPLKLRRGPGkspgNSQPKVPRKATS--------KGP 236
gi 1032959071 189 LYPGVYPAMQLSVVLEALVPLKTP--CLGAKHRAqspqLSLANSSLKLRKGSG----NPQSKASQKITS--------KGI 254
gi 514473788  165 LYPGVYPAMRLSVVLEALVPLKNPmrCLNAKHKPqslrLSLANSPLKLQKGSGkspeKSCSKAPRKTTS--------KGA 236
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81902049   227 KHLTSKGPGA---------GL-------RRGAGTQSN---------GAqrkgcsaLGPKTVQAQASQtlikaARAHASva 281
gi 612041225  224 RCLIRKAPDRaalpkggrrGP-------SGGVLRESNackasgilnGR-------RRKKGTQVKTSKrgartACRGGR-- 287
gi 149447973  229 QNVVKKTRlaeg----flrSP-------GGRVLQESNackasgilnGR-------ISSSSSQGCSGG----------Sps 280
gi 972972942  230 QADKMRVSSCpvkmavalvGDsttvtcqNDRVLKESNsykm---vpvR-------IGK----------------TNAPgd 283
gi 987959303  231 KCVIRRGPSA---------GP-------QESTGPQSKtcratgsllGPqmkgvsaLSTKTAQAKAAQalarvACAQATaa 294
gi 823467528  231 KRLVKKAPDSatcalkllkGP-------NGGVLQESNackasgvlnGR-------VAGSSSQ----------DCATAPqp 286
gi 565318638  333 RHLITKVPDSaaltmslikGP-------KGGVLQESYackasgilnGR-------ISGSHSQ----------SCSTGAsr 388
gi 637273060  240 RHIIKKVPDStsltvslmkGP-------KGGVLRESNackasgilnGR-------ISGSPSQ----------SCSQAAtr 295
gi 426340528  237 KCLTRKGPGA---------GP-------RRGSGHQSKtnratgspsVRrmkggsaLGTKTAQAKVARtlakaAHAQAKva 300
gi 311268897  237 KGLTQRGSRA---------GP-------RQGNGPQNKtykatgslsSPrmkggcsLGTKIAQAKAARaqakvARTQAKva 300
gi 1032959071 255 KCLSRKGPGA----------D-------PQGSGPRSS---------GLrvkgcsaLGTKTVQAKASRtltkaAHAHASla 308
gi 514473788  237 TCLTHKGSRA---------GP-------QQGTGSQRKtckaigsvrGLqmkegstLGTETAQVKATRtlakaAQNSGNva 300
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81902049   282 qtqtktvrvrakakqakpkaarakakaavvrdk-------------------akdkviqakakaaqtkhkgkpkgsvqtr 342
gi 612041225      --------------------------------------------------------------------------------
gi 149447973  281 kaprskapd------------------------------------------------------------------vpvgr 294
gi 972972942  284 klgwsdk-----------------------------------------------------------------------ds 292
gi 987959303  295 qtqakaakaraetkaawikakakaraararaka------------------karaarataartqprgrgrgrlkgsvqar 356
gi 823467528  287 ktlkikdke------------------------------------------------------------------vlvgk 300
gi 565318638  389 ikepsv------------------------------------------------------------------------ak 396
gi 637273060  296 nkepsv------------------------------------------------------------------------dk 303
gi 426340528  301 rtqaeaakaqakakaarvkakakakaarvkakakvmaara-----rakakakakavrakakvartqprgrgrpkgsakar 375
gi 311268897  301 karakakaaqikakakaararakakakavqakakakaarararakskavranakavqakakvariqprgrgrpkrsvqar 380
gi 1032959071 309 rtqnktvrvrakttktkpraagakakatvvrnk-------------------akakvvkakakaaqtkhkgrpkgsvqnr 369
gi 514473788  301 riqakakaardkakakairdkakakairdkakakairdka----kakaawnkakakaarnkvaqiqlkgrgrpkasvqps 376
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81902049   343 tgranrKNSSETVG-RKRKKAEETKG-LPPKKRARCVPRPPKVWLGPG------TAKPRKSQTIKVDRKCSDDEVRQCAQ 414
gi 612041225  288 ------GSHPEATG-PKRKRAEEAKE-TPAKKKSKLGPGLSKARLVPS------SPNLLKFRVIKVNKRFSDEEVRQRAQ 353
gi 149447973  295 idwrdgSDDPRETGaRKRKRAEAVKE-PPPKKKTKSVPCLTKSELGQS------TLNLLKFWIIKVDKTSSDDEVRQRAQ 367
gi 972972942  293 vrvlncQPDVEV---RKRKRLEEPEE-PTAKTRPRNG-----SWVGNGqdesglNENNLRFKVIKVDDSITDEEVRRKAQ 363
gi 987959303  357 tarkgqKGSPGTGG-QKRKRTEEAKD-HLPQKRARLGARSPKARLRLG------TSTLLTLRAFKVDQRSSDDEVRRQAQ 428
gi 823467528  301 tewkdsSTYQESTG-QKKRKATEAKE-APQRKKTNTIPVRKKTQQVQS------TLNLLKFRTIKVGNSSSDDEVRRRAQ 372
gi 565318638  397 teresgGSHQQAIG-EKRRSADEGKElLPRRKTPSSVPPPNKPELASK------AFNLLKFQAIKV-DSSSDDELRRRAQ 468
gi 637273060  304 tgwrggSSLQETAG-QKRKRGEERKE-LSCRKNPSSVPSPSQVELHSK------TLSLLKFQAIKV-NSSSDDELRRRAQ 374
gi 426340528  376 ttrkgqKNRPETVG-QKRKRAEEAKD-LPPKKRTRLGPRSPKAWLGPG------TAKLLKFRAIKVDRRSSDDEVRQRAQ 447
gi 311268897  381 tarkgqKRCPETVG-QKRKRADEEKD-LPPRKRTRLGPQSPKMWLGRG------TAKLLRFQAIKVDRRSSDDEVRQQAQ 452
gi 1032959071 370 tgrtslKSGSESVG-KKRKKAEEVKG-LPPKKRARLVLQSPKARLRPG-------AKPQKSQTIKVDRKFSDDEVRQWAQ 440
gi 514473788  377 msrkaqKSHSVTLG-QKRKRAEEAKD-LPPKKKKRLESQSPKSCLGSG------TAKLIKFRAIKVNRQSSDDEVRQQAQ 448
                         490
                  ....*....|....*.
gi 81902049   415 QILRVNLSPVVWLQPL 430
gi 612041225  354 KILRVNLSPVIRIQPL 369
gi 149447973  368 KILRVNLSPVIRIHPL 383
gi 972972942  364 KILQVNLSPVIEIRPL 379
gi 987959303  429 RALRVNLSPVIRLQPL 444
gi 823467528  373 KILRVNLSPVIQIQPL 388
gi 565318638  469 QILKVNLSPVIRIQPL 484
gi 637273060  375 RILRVNLSPVIRIQPL 390
gi 426340528  448 RILRVNLSPVIRLQPL 463
gi 311268897  453 QILHVNLSPIIQLQPL 468
gi 1032959071 441 QILRVNLSPVVWLQPL 456
gi 514473788  449 QILRVNLSPVVRLQPL 464
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap