Conserved Protein Domain Family
DUF4605

?
pfam15378: DUF4605 
Domain of unknown function (DUF4605)
This protein family is a domain of unknown function, which is found in eukaryotes. Proteins in this family are typically between 82 and 137 amino acids in length.
Statistics
?
PSSM-Id: 317745
View PSSM: pfam15378
Aligned: 21 rows
Threshold Bit Score: 34.4371
Threshold Setting Gi: 762146008
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 75022864   157 IIETINERLQGFGISGVNFAGFQLQPFHLLLAIALLIIFGPFGLLIALAVCFFTQ 211
13_pfamImport   1 VFESLNGTLRGYGLTDLTVGGFTIQPSHLLIALGLLLFLGPFGLVIGGAIIFFTQ 55
gi 82179429    59 PFSEINQQLVNMGFPRWNLGNQVVEPVMSILLLFLILMVGVRGLLLVGLIYVVSH 113
7_pfamImport    2 PFSDLNRQLVNMGFPQWHLGNHVVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSH 56
gi 198418857   65 VFDTWNEKLLQLGIPRWNIGSHVVEPIMTTAMVVVLLMFGLPGVLFLGLLYFVVT 119
gi 675854508   60 IFDTLNNQLVSVGVPTWNLGPYPVKPIVSVGFILSIAVMGFRGLLFSGLLFFVVN 114
gi 762146008   61 VFTLINQKLLDFGIPRFNVGPYVVEPIALVGMILAGLMFGLPGLLFGGVLFMVVM 115
gi 308461619  159 IIDTINQRLNGFGIPNIDAGGFQIQPFHMCLALTLLFFFGPFGALIALAICFFTQ 213
gi 260802704   53 MFDAINQKLLALGIPRFQLMGTTVEPIATVGVTVVFLLMGVRGLLFIGLLFGVSY 107
gi 620962219   54 pFSELNRQLGNVGFPLWDVGNRVAEPVMSILLLFLLLMLGVRGLLLVGLAYVVSR 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap