Conserved Protein Domain Family
DUF4607

?
pfam15380: DUF4607 
Domain of unknown function (DUF4607)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 207 and 359 amino acids in length.
Statistics
?
PSSM-Id: 317747
View PSSM: pfam15380
Aligned: 8 rows
Threshold Bit Score: 356.495
Threshold Setting Gi: 914903894
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 989963272  184 VACKKLLYTCQYSIPSS-PdVSRASFEEENH--EEASSHTTSsSEWYENPLIFTVRQEINKRDREAPKQAWSSLVLEKPV 260
gi 831214494    1 MAYKRLFCTYKYIVPKS-P-VSPESFEEEEErcGEVCPSPTP-SETDEAPLISTAREEIRKRTKGVPKQAWSSPFVCQQM 77
gi 914903894   30 VTCERLLHTCQPIIPRS-S-VSTDSFEEENR--QEACSTPAScGERDEDSLSLMLREKVPKTISKTSKQTWSIPFFAPKM 105
gi 568968892   26 TG-KRLLCVHQYTIPKS-P-ASTISLDEEIG--GEARPSLSSsSEMEEDDLLFTINEE-QKPPRRLPNQTWISPFLEMQA 99
gi 1040219951  55 VAFKRLLCTRQYIIPRS-P-VSTSSFDDENY--GESCPTPTPsSERDEVPPSFTVGGKINRPNRRVSNQAWSSPFLEQQM 130
gi 114646581   96 MACKRLLHTCQYIVPRC-S-VSTVSFDEESY--EELRSSPAPsSETDEAPLIFTARGETEERARGAPKQAWNSSFLEQ-L 170
gi 545206113   25 MACKRPLCTRQCLIPRSpA-VSIASFEEDSY--GEAGPFPTPsSEWDETPLIFTVRQEINKRAREAPKQAWSSLVLEQQM 101
gi 731457903   20 leYKTLLCTRQYSFPRSpP-VSPASSKEESY--IEDILYSTLfSENSEVPLTSAAKKGIKKRTRRPPQQAWSSPFLESQM 96
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 989963272  261 TEM-PIPSYSAYPLRLEAAGTQLIRHVRLQNQPSRNSKRN---PvppGTTERPSTAIGLCG---RSQTPWAPMRVSWSSS 333
gi 831214494   78 GQK-SIERYLANPLHLEAAGTHMNRHKRVQNQPSTSAKGN---S---GSGARPSTAIGVCR---RSQTPQARRSVWRSSS 147
gi 914903894  106 ANK-PSLPHSEHPVYLEATS----RHTRLQNQSLSDSKGN---S---RPPGRPSTAIGLCRtrsRSAPPSA--------- 165
gi 568968892  100 ASKlLKKSHSVNTISLEAAG----RHIPLQNHPLVNSKGD---S---GPALRPFTAIGLCR---SVSQNYSSQPISCKTS 166
gi 1040219951 131 AKK-PVLPHSVNPIHLEAVGIHFKRHRKPQNQSLDRSKGD---S---GPAARPFTAIGLCG----NHGPFAQQSVWRSCS 199
gi 114646581  171 VKK-PNWAHSVNPVHLEAQGIHISRHTRPKGQPLSSPKKN---S---GSAARPSTAIGLCR---RSQTPGALQSTGPSNT 240
gi 545206113  102 AGR-PSPFCSVNPLHLEAAGTHIKRHARPQNQPSHNSKAD---SvspGpapRPYTAIGLSR---RSQTPLAPWRVSWSSS 174
gi 731457903   97 AKK-PTQPHSIDPVYLEAAGRHIDRHARLPNQSYCNSEEYpvlY---GSSARPFTAMGLCR---RSQAPVTVQEASESFS 169
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 989963272  334 DTMLEERMA-ATADALANPDSQSRLQGVPGNPVGRDTVAMTPEMLPKHLHPLGKKEPRADASPH---DSLAGAPLLQLAG 409
gi 831214494  148 EPELEEPTAeTPAGFPAPRDVPCGLRCASGNPAGQSPVAMAPETLPKHPQAPGERRPGGDTSLQ---GELTVSPLPLLAG 224
gi 914903894  166 --RVEERAA-VTVDFGAHPDSPEGLPGAPGNAAGRGAVAMVAEMLPKHPRVPEEPRLRADASLSslwGNLAEEPLPGPAG 242
gi 568968892  167 ETVQEDKAT--ASGSPTQTDS----LTVCGSALGRGAVAITPETTLKHPHLPTERRPKAVISFP---ARVVKEPLPLLVG 237
gi 1040219951 200 DPELEGRVA-----APAHRDVHSRLLGVHGSAVRGGAVAMAPETLPKHPPALEERRPRADSALR---GSLAGAPL-LLAG 270
gi 114646581  241 ELEPEERMA-VPAGAQAHPDIQSRLLGASGNPVGRGAVAMAPEMLPKHPHSPRDRRPQADTSLH---GNLAGAPLPLLAG 316
gi 545206113  175 EPELEEKRT-ATVGALANPDVQSRPQGATGSLVVRGAVAMASEMLPKHPHPPGKREPRADASLH---GNLAGAPLPRFAG 250
gi 731457903  170 EPELEQRTA-TTEGALANPDFQSGLRGAQGNPLGRCAVTMAPEMLPKHPHVPGKRGPREDASLQ---GNLEGAPLPRLAG 245
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|..
gi 989963272  410 SPTHLPTKRLIVTCSYPPSRPPQRFHTVCSQAPPRLRVNAHL 451
gi 831214494  225 ASTLFPSKRLLKVCSAAPPRPPRRYHTACSQALPRPVVNAHL 266
gi 914903894  243 ASTHFHSKRLIKVCTAAPPRPPRPFHTACSQAFPRPVVNAHL 284
gi 568968892  238 SSTRLFSKKLMKACSSVAPRPPQDFHKACSQSLSKPVVNTHt 279
gi 1040219951 271 ASTPFPSKRLIKVCSSAPPRPSRGFHTACSQALSRPVVNAQL 312
gi 114646581  317 ASTHFPSKRLIKVCSSAPPRPTRRFHTVCSQALSRPVVNAHL 358
gi 545206113  251 APTHLPSKRLIKVCSAPPSRPPRGFHTVCSQAPPRPRVNAHL 292
gi 731457903  246 VSTHLSSERLIKFCFSPPSRPPRRFHKACSQAPPWPGVNAHL 287
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap