Conserved Protein Domain Family
DUF4616

?
pfam15394: DUF4616 
Domain of unknown function (DUF4616)
This protein family is a domain of unknown function found at the C-terminal domain of the proteins. This protein family is found in eukaryotes. Proteins in this family are typically between 166 and 538 amino acids in length.
Statistics
?
PSSM-Id: 317760
View PSSM: pfam15394
Aligned: 4 rows
Threshold Bit Score: 680.543
Threshold Setting Gi: 556972581
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 635141815   2 SFSATILFSPPSG-SEARcccCACKSEtnGGNTGSQggnppPS---TPITVTGHGLAVQSSEQLLHIIYQRVDKAVGLAE 77
gi 301624545   2 SFSATILFTPPPGhSEEK---CGCKSE--GIQARSV-----PVdgvTPINVTGDGVAVQGCEQLLHLIYQRVEKAVGIAE 71
gi 556972581  71 saeaalsmakannglliklqeeigeiksmkvqerdkscqggrqeqptrtadqkdisvpkavqsenitslqtgigelrpfg 150
gi 327289323   2 SFSATILFSPPNA-KEAKcccCTCKQEpaAQTSAPPplpppPSppcTPITVTGSGLALQSPDQLLHIIYQRVEKAASLAE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 635141815  78 AALGLARANNELLKRLQEEMGELRQGKVSTpdedgesrAHSSPPEEPGPLKE-SPGEafkalsavEEECDSVgSGVQVVI 156
gi 301624545  72 AALDVAKANSNLLSQLQEEMSGLRKLTENTe-------KDKFPVQMPAANTKcKISE--------DEEVEEI-RGVQVVI 135
gi 556972581 151 galsmpgtlmhfpvnrsprdvrtstrhiqdevapgpsaeehneaaspvptvvaptytsqlsspspvcitrladsnieiev 230
gi 327289323  81 VALSLAKANNEALKRLEEDVGALRRGTPPS--------LKASPPCVPEEHQEdAEGEee-----eEQEAEGFgNGVQVVI 147
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 635141815 157 EELRQLGAASVGPGPlGFPATQRdmrlpg----ctlaaSEGAPLLN----PLVDDYVASEGAVQRVLVPAYAKQLSPATQ 228
gi 301624545 136 EELRQLGAASASLVP-GFHTPSMdrtpkdgclsagpspGEANPLLSpmhvPVIDDFLNTEAPAARILAPSFVKQLTTSRP 214
gi 556972581 231 edlseeavspspvtldtathdatrrapmlpptpsrlkagkstkrkrdlllsALEDYNTTIPPIQRVVAPTFNPELSPPSP 310
gi 327289323 148 EELRQLGAAAGPPGHlGFSPVQL---------------GTGSGGLA----GVAENSSAGDASMQRVYA-------TPSS- 200
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 635141815 229 LAiqratsetGPEN-----GTKLPP---PRPEDmlN--ATAALDSALEes--gPG---------ST-------GELRHSL 280
gi 301624545 215 HGd------tVEVL-----SESAPPimkPTLST--HshLLIQRDGSLS-----PGgivmaetssAS-------AEMRPSI 269
gi 556972581 311 PVcitgladsNIENemedlSEKSVS---PNPAT---------LDSALD-----PI---------TH-------GAVMRAF 357
gi 327289323 201 ----------------------------PTPHE--S--ALQSLDDSLSyaevsPN---------STtledsmhGEPRFSL 239
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 635141815 281 G-------LTVSPCRTRGSGQKNSRRKRDLVLSKLVHNVHNHITNDKRFNGSESIKSSWNISVVKFLLEKLKQELVTSPH 353
gi 301624545 270 SppplasfYACTSSRQRGNGQKCSRRKRDLVLSKLVHNIHNHISNNRRFNGSESIKSSWNISVLKFLVEKLKQELVSSIN 349
gi 556972581 358 Q-------MPLAPLRPK--GTKNARRKRDLVLSKLVHNIHNHVSNDRRFNGSESIKSSWNISVVKFLVEKLKTELLARSH 428
gi 327289323 240 G-------FASLPSRSRSSGQKNARRKRDLVLSKLVHNVHNHVTNDKRFDGSESIKSSWNISVVKFLLEKLKQELVSNQH 312
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 635141815 354 NYTDKELKGACVAYFLTKRREYRNSLNPFKGLKEKEEKKLRSRRYRLFANRSSIMRHFGPEDQRLWKDVTEELMSDEEDS 433
gi 301624545 350 HYTDKELKGACVAYFLTKRREYRNSMNPFKSLREKEEKKLRSRRYRLFANRSWGVQQFPVEDQALWEGVTEELMSDEEDS 429
gi 556972581 429 RYTDKELKGACVSYFLTKRREYRNALNPYRSLKEREEKKLRSRRYRLFGNRSFIVKLFSPEDQHLWEGVTEELMSDEEDS 508
gi 327289323 313 NYTDKELKGACVAYFLTKRREYRNSLNPFKGLKEKEEKKLRSRRYRLFANRSGMARLLSPEDQCMWQSVTEELMSDEEDS 392
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 635141815 434 LNEPGVWVARPPRFRAQRLTELCYHLDANSKHGTKANRVYGPPSDRLPSAEAQLLPPELYNPNF---QEEEDEGGDENAP 510
gi 301624545 430 ISEPGVWVARPPRFRAPELTRLCYRIDSHSKHGNKTNRVYGALSDRLPSAEAQLLPPHLYNPDWegdQIDSDAGGVDGGG 509
gi 556972581 509 LDEPGVWVARTPAFRSQQLTDLCYRIDANSKHGSKSNRVYGPPSERLPSVEVQMMPSHLFNRDFh--QQLNDLQILEETV 586
gi 327289323 393 MSEPGVWVARPPRFRAAPLTRLCYRLDANSKHGTKANRVYGTPSDRLPSAEVQLLPQHLYNPHF---QEDESKAGTSPHP 469
                        570       580       590
                 ....*....|....*....|....*....|
gi 635141815 511 vspsfdQPHKTCCPDL--NSFIEIKVEKDE 538
gi 301624545 510 ------RGRKSFCPDL--NSFIQIKVEKDE 531
gi 556972581 587 ------HPNKGFIHEAasSSFIEVKVEDDD 610
gi 327289323 470 ------PSHKSFCPDL--SSFVEIKVEKDE 491
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap