Conserved Protein Domain Family
DUF4617

?
pfam15395: DUF4617 
Domain of unknown function (DUF4617)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 702 and 1745 amino acids in length.
Statistics
?
PSSM-Id: 317761
View PSSM: pfam15395
Aligned: 20 rows
Threshold Bit Score: 868.661
Threshold Setting Gi: 565306628
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452  669 SMEVLATCLSLWKKQP--------SDTAKE---KECDKLRTNTTAVGISKPA-NIHVKspcsvvgnsNSQNKISnpSQQT 736
gi 156630980  451 SMELLATCLSLWKNQPsktteenvPKPLEE---KQCNTSRISTTVVGSANPTnEVHVKslcs--gvgNSQKMMS--SSQT 523
gi 351697812  450 STELVKTCLNLWKNQPskmteekaSKSAEE---KQVNESLTNTSA-GISKPL-EVPIQnpcs--verNLQSKTVnvLQEA 522
gi 884897788  324 SMELVKTCLNLWKDEPskmaeekaSNPAGE---KQATEMTDAST--GMSKPP-EVPVEnhps--ierNPQNKAVnpLQEA 395
gi 637299515  702 SMEELQTSLALWKKSLpeslngklCESTQSiglSSTEGGKDYKIIQSLQSCT-NKFIQ---------NDQAQVTf-QSDG 770
gi 565306628  696 SLEELKTSLALWRKCLpkslneliNRNNE----SSSDGMDGKGTAKSLENLP-NILTQ---------NYDTKITv-ERTQ 760
gi 971372218  703 SLEELNACLGLWKKQGs------ePVSVQN---SQSNESTAANQISPLPHSQ-NTTNK---------REQGNLLvsTDVT 763
gi 733870716  756 SLEELTACLDLWKKQGp------ePVSVQN---SLSNENIAANQISSLPHGQ-NAANK---------REQGN-LvsADVT 815
gi 564349878  446 SMELLATCLSLWKNQPpktteenvPKPLEE---KQCNTSRISTTVVGSSHPTnEVHVKsfcs--gvgNSQKLLS--SSQT 518
gi 514792775  717 SAEELTACLGLWRKHGs------ePASIQN---SQSNESPTENQISSLPYSQ-NTVSK---------REQGSLPdsTGEA 777
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452  737 ALSMVM----HNYESSGINITKGTELQIAVVSPLVLSEVKTLS-VKGITPAVLPETvYPV--IKEGSVCSLQNQl-AEna 808
gi 156630980  524 VLPVLI----PSCESSGVAVGKGTELQIAVVSPLVLSDTNTLP-GKDSVPEVLPETlYPV--VKEGSVCSLQTQp-TE-- 593
gi 351697812  523 ALSMLV----QNYEPSCANVTKGTELQIAVVSPLILSNV-----IKEITPGALPETvYPI--IKEGSICSLQNQq-AEna 590
gi 884897788  396 TLSMLV----QNYEPSCANVAKGTELQIAVVSPLILSNV-----IKEITPGTLPEPvYPV--IKEGSICSLQNQpaAEna 464
gi 637299515  771 TAQTFVpiarKTHDIENSNLLKGAEPQVAIVTPLMLSKD------------------YVQiaVQNNSPVSQNLK------ 826
gi 565306628  761 IYGSFe----KNLDAVNSNLPKGSEPQVAVVTPRILSKNNDVQ--------KNNESiYPAtdIEEGTVHTLEKAi----- 823
gi 971372218  764 VLPLTTtsigQKHDALSCNLIKGLELQIAVVSPLVLSNQRAQSeQVDKCPTSADKT-YPV--IDTGSICSMQEE--GKnv 838
gi 733870716  816 VLPLTTtsvgQKHDMLSCNLIKGLELQIAVVSPLVLSNQRAQSeQVDKCPTSADKT-YPV--IDTGSIRSMQEE--GKn- 889
gi 564349878  519 ILSVLT----PSGESSGVAVGKGTELQIAVVSPLVLADTNPLP-GKELAPEVLPEPpYPV--VKEGSICSLQHQq-AE-- 588
gi 514792775  778 VLPLTTasvgQKHDMLGCNLIKGFELQVAVVSPLVLPKQVTQSeQADKCQKSADKT-CLV--IDTGSICSLQEE--GKnv 852
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452  809 kaTAALKVDVSGPVASTATSTKIFPLTQKE-KQ----------NESTNG------------------------------- 846
gi 156630980  594 --TVALPFDVIGAVASNNISAEIPLPVDKE-KQ----------HKPIQG------------------------------- 629
gi 351697812  591 avTTALKVDVIKPVMSSTTSAKVFPLIQKE-KQ----------NEPNNG------------------------------- 628
gi 884897788  465 viTAALKVDVTKPVVSPTSA------------KvipliqkekqNEPSNG------------------------------- 501
gi 637299515  827 --------EIKDTNCSSSESIKHRKDLDTShKA----------NISTQDngiikaetqn---------------nccfel 873
gi 565306628  824 -sTKSDSNKEKRTIYSPTDSYKYCDLNEHQ-GI----------NRPTGNnkivkevgt-----------------nhsfd 874
gi 971372218  839 ltVVNTDRRTMESV-SSPDDCILIQMEDLCsQQ----------TKSAGGkrivensmnandscge---nerklsqatrdd 904
gi 733870716  890 --VVNTDKGTIESVSSSSDDCILIQTEDPClQQ----------TKSADGkriiensvnandscge---nkrklsqamrda 954
gi 564349878  589 --TAALPFHITGVVADSNLSVEMSLPAQKE-KQ----------HKPTQG------------------------------- 624
gi 514792775  853 ltVGSADKGTVEPVCSSPSDCVLVEKENSHlQQ----------NKSANGnrigkssmstndlsdekqrklcqtmedagen 922
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452  847 ----NsevtPNVNQ---GKHnklesaihSPMNDqQISqESRNSTVVS---------------------------SDTLQI 892
gi 156630980  630 ----D----PDIADsslGKH--------SPLGT-EVLpKPMDSTIVS---------------------------GPMLQI 665
gi 351697812  629 ----NaqntPSIHEeq-----------hCQMNGpQSSsKSKDRTLVA---------------------------GDLLQI 666
gi 884897788  502 ----NlqdvSSAHVeq-----------gCGLNGlQTLpKPKDRALVS---------------------------DDLLQI 539
gi 637299515  874 sqvrNshspPELK----SLQseldsgdyLPPDN-QVSqKCVLSQAISdlveard-------------ideivenDTVLQI 935
gi 565306628  875 lnqeKtnslPlgl------------kqyALNSGvQHQcELITNHLIAspltcvtskkhgpnldessntadiglkDSMLQI 942
gi 971372218  905 eenlQnkllPESGQsfsSKTfqedikdhDGKQAvLETqNNTPTAVIE---------------------------EQMFHI 957
gi 733870716  955 eenlQnkllPESGQsfsSKTfqedtknhDGKKAvLGTqNNTPSAVIE---------------------------EQMFHI 1007
gi 564349878  625 ----D----PDIADhgl--------gklSPLGT-EAVpNSVDSTTVS---------------------------GPMLQI 660
gi 514792775  923 lrsqNksslSELDLnfyGQIfqegkkdcEDKQTvLET-GTIPTALLE---------------------------EQMFHI 974
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452  893 DNICSLVEGDTSYNSQIAKIFSSLpl---kMVEPQKPSlPNQQGIGsrePEKQLD-----------NTTENKDFGFQKD- 957
gi 156630980  666 ESICSLAEGDVSYNSQIAEIFNSV------QTEPQKPS-PNQVIDS---QQEQVY-----------DTTENKDFSLQKD- 723
gi 351697812  667 EDICSLIEGDVSYNSKIAKMFNSSpl---eKVEPQKFSlPNEQVIStghQEEQVE-----------QASESKDMGLQND- 731
gi 884897788  540 ENICSLVEGDVSYNSKIAKMFSSSpl---kKVKPSKVSlPSQqvIStayQKEPVE-----------PATESKD-----S- 599
gi 637299515  936 SSVCSLVKGDACYNSQIASIFNTSpl---tSSMENATSlKDCLPYLqcnNQQSVIletgpeseksiSVTERNALLPSPS- 1011
gi 565306628  943 ASVCTLVEGDAFYNSQIADIFSASlskpgiKFEISEEHmPSLq------HNEDKFgllkndpevgmSLSEEEGILLPSG- 1015
gi 971372218  958 ASVCSLVEGDKSYNPQIASMFSSVp-----QTHAFNSGtSSEENASdprQKEQLMklnkn--dlreNTSQLETLLQKALr 1030
gi 733870716 1008 ASVCSLVEGDKSYNPQIASMFSSVp-----QTRAFNSGtPSEVNVSdprQKEQLMklnkn--dlreNTPQRETLLQKALr 1080
gi 564349878  661 ESICSLAEGDVSYNSQIAEIFNSV------QNEPEKPS-PNQVINN---QQEQVD-----------GTTENKDFSLQKDk 719
gi 514792775  975 SSVCSLVEGDASYNPQIASIFGSVh-----QTNTLNNGtSSGENASdprQKEQLLdlnkn--dlskNSLQQETLLQKTSg 1047
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452  958 KPVQCTDVSHKICDQSKSEPPLE-SSFNNLE-TNRVILEKSSLE----HATE-KSTANDTc-sSAAIQ-EDIYPQEIDAS 1028
gi 156630980  724 KCVQCTDVPHEVPEQPEPLQPEEpASSEYVE-ANREATEESCRE----YTGRkESTAKDVc-lPAAIQ-QDPHPRETDMF 796
gi 351697812  732 ECIRCTDFPCEI-DTVRREEPPKlVGTSSSDkKKPGILPESNLE----KTTKnEGMAKNTccsPAAVL-QDFNSGDIDTS 805
gi 884897788  600 KYVQYTDFPYAI-AVVRREEKQElVGSSFVE---PGVLEESNSD----RTPEdLDTPRDAcysPAAAAkQDISSEDFNNS 671
gi 637299515 1012 ---TLNNAVEEILKQVPALEMDQsYKTANEM-NERNSEEDKKKE----KKFEqNVSGIDVhisDFASDtQELCQNKYDQL 1083
gi 565306628 1016 ---SLSKALSGNLEDLQTLESPQcDKTSVET-NASNSEKQKDNDflevASLSgKKNEQDI---SYGCN-MDLSNNKVFEN 1087
gi 971372218 1031 ES----SEVDKILNSTVTSHSKKeSSGMLPN-TVTTSEQKKPVN----LSFRyPENDLGI---LASIN-QELARNSLDSL 1097
gi 733870716 1081 ESSCCISEVDEILNGTITSHSKKeSSGKLTS-TVSTSEQKKPVN----TFLKhPENDLGI---LASIN-QELARNSLDSL 1151
gi 564349878  720 KYIRYTYVPREITEQPEVLQPEEpASCEYVE-ANTETIEESGRE----CSGGkESTAEDVc-sPAGFQ-QDPHPQETDSL 792
gi 514792775 1048 ESSRCVSEAGRTLDSFKTIHSEKeSSGNPPR-TNSASAKKMLVN----ASFKhPENNLDV---LPRLD-QELAQSSPDFL 1118
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1029 SNYTPQ---------------DPARNE------IhSD-----KAPVLYLHDQLSELLKEFPYGIEAVN------TREGSV 1076
gi 156630980  797 SKSDHS---------------LPAINE------InDE-----SEPISYLHDQLSELLKEFPYGIETFN------RHEVSL 844
gi 351697812  806 GNDTAR---------------GPTASE------IpND-----NTSVLYLHDQLSELLKEFPYGIDDLN------TYKSFV 853
gi 884897788  672 SGLPAQ---------------HPAVGD------SqDH-----PTC---LHDQLSELLKEFPYGIEGLN------PYGSFV 716
gi 637299515 1084 SSSVADdiggig----kegtaEENTES------GsNT-----EAPVTFLSDQLTELAEEFPYGLCYSKtln-etGSNDSV 1147
gi 565306628 1088 QDSLCEtnnmssi--rkagdsEHTVDErkeahlGsST-----ESSVTFLNNQLTELSKEFPYGIGYLNmvk-eiENKDSI 1159
gi 971372218 1098 VSITAEtnaftvttcsskeivTSTKKS------VeEElhvfgAEPITCLDNQLTELMKEFPFGIEGADiltkepARNNSV 1171
gi 733870716 1152 VSVTAEtnaftvttcsrkenvTSTKRS------V-EElhvfgAEPITYLDNQLTELMKEFPFGIEGADiltkepARNNSV 1224
gi 564349878  793 SNKSAHc--------------LPAVNE------InDE-----SEPVSYLHDQLSELLKEFPYGIETVS------RHEVSV 841
gi 514792775 1119 MSVTAEtnvfsvttdvnkendTSTKNS------I-EEvnlfgAEPIKYLRNQLTELLQEFPYGIEGADlltkepVRNDSV 1191
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1077 GQQTTYQTSEDQTADKTSSDSKDPADQIQITILSSEQMKEIFPEQDDq-------PYvvDKLAEpQKE-------EPITE 1142
gi 156630980  845 DQQKTHKIVENQTGGKTSNVSGDSTDQIKITVLNSEQIKELFPEDDQ--------PC--DKLAEpENK-------EIVAE 907
gi 351697812  854 NQKKMGQIPEDQTGGKISCDSKGPSDQIKITILSSEQMKELFPEQDEpsegdrppPPkvDKLAEpQKE-------KHIAE 926
gi 884897788  717 SQ-KTEQVSEDQSGGKVSFHTKEPTDQLKITVLSSEQMKELFPEQDE--------PRdaDTLQHhEVDkseppkkKCVTE 787
gi 637299515 1148 PKL---NDSGNVQSSEKFPDSSDAIDQIQI-ILNSQQSKEVLPEDKQqfsn-ksvNSesNDLKTdSEH-------KLTRE 1215
gi 565306628 1160 TILTERKDKENTMSHGKSLDPSDAVDQIKIVILNSQQMSEVFPECSQqssn-kldNHggDWMRMdSKH-------NFSKD 1231
gi 971372218 1172 AEQREN------HVSAKKTDSKNPIDQLQIAQLNSDRVQELLPEKRLc------sSTenSGAMSqQSE-------KTSTQ 1232
gi 733870716 1225 AEQRENQPQKEPHVSAKKADSKNPIDQLQIAQLDSGQVQELHPEKKLc------sSTenSGALSqQSE-------KTSTQ 1291
gi 564349878  842 DQKKTHKILENETGDKTSNVFGDSTDQIKITVLNSEQIKELFPEEDQ--------PCdlDKLAEpEGK-------N-VAE 905
gi 514792775 1192 LERTEKQTQKETQISDKKSNSKDPIDQLQIALLSSGQVQEIFPEEKSc------sSSesSRALT-QPE-------KASPQ 1257
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1143 VVS---------------------------------QCDLQAPa----AGQSRDSVILdSEK----DDIHCCALGWLSMV 1181
gi 156630980  908 VKS---------------------------------PCDSQIP-----REESHDLGMLdPEK----DKIHCCALGWLSMV 945
gi 351697812  927 VGS---------------------------------QCDPQKQe----EGESPDSV---GDT----EKIHCCALGWLAMI 962
gi 884897788  788 VES---------------------------------QCDPLIPp----GGENPD---CpEDT----DKIYCCALGWLAMI 823
gi 637299515 1216 NVSl--------------------------------KTDNAIDv----ETGVTSSETTlTSK----KQTYCCLQGWLASS 1255
gi 565306628 1232 IGHy--------------------------------RKSNQDL--------NVDRKMVrSERlaktERTYCCLPGWLASK 1271
gi 971372218 1233 EDSl--------------------------------ESSVQPSqslckEKENPQSPSSsGNK----EV--CSLTGCLSAS 1274
gi 733870716 1292 EGSlecsvqpslcsstensgalsqqsektstqegspECSVQPSqslckEKESPQSPSSsGNK----EV--CSLMGCLSVS 1365
gi 564349878  906 VKS---------------------------------PCDSQVP-----REESHDFGMLdPEK----DKIHCCALGWLSMV 943
gi 514792775 1258 EEKl--------------------------------KSNVQPDqslckEKENPQPPPN-SRK----EDNYCCLMYWLSEL 1300
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1182 YEgVPQCQCNSiknsssEEEKQKEQCs-pLDTNSCKQGERTSDRDVTVvQFKSLVNNpk----tpPDGKSHFPE------ 1250
gi 156630980  946 YEgVPQCHCSS------TEKKEKDQC---LDINSSKQGEQPCNSGITIfEINPVSNNsktp-ltqATEEGHFSA------ 1009
gi 351697812  963 YEgVPKCRCNAv-----EEDKREEQSa-pVESSGCKQGPKTSDADVTV-KLDGVLDKpktp-ltaAAEKTHLPK------ 1028
gi 884897788  824 YEgVPKCRCNIv-----EVNKEEVQQa-pWKTSNCEQGQQTITAGVTAaQCDDVSPYpktp-paaVPEKSHLTKkndnni 896
gi 637299515 1256 YA-MEPCACMQakesasKQKVDLLSEsetAGKDKPEASENF--------NVDFRLNNqlptstldTVTKKVSSE------ 1320
gi 565306628 1272 YN-VEPCSCMLakepslKGK---------TDSQSKERSKSN--------ESDCSLKNevqnsildTGNNIFLLG------ 1327
gi 971372218 1275 GE-MSQSSCKRrt--svSD-KNGEQLseaENPNSAGRQENNSKSDAII-KNSSVVENp-------PICENVQNS------ 1336
gi 733870716 1366 GE-MSQSSYKRrt--svSD-KNAEQLseaENTNSAGRQENNSKSDAIM-KDHSVVENp-------PICENVQDS------ 1427
gi 564349878  944 YEgVPKCHCSS------NEEKGKDQC---LDMNSCKQGEQPCNNGITIfEINPVSNNpktp-ltqAAEKGHFSE------ 1007
gi 514792775 1301 GG-VPQGSCECgt--sgSDKKDNDQCseaENINSAERQENNSKSDAPV-KNNCASGNp-------PTSENVTNR------ 1363
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1251 --------------------LQDDS-----RKD----------------------TPKTKHKSLPRTEQEl-VAg----- 1277
gi 156630980 1010 --------------------VHGEKtkaskTKDnregqelachfsakcykkdkkgNFKIRHDTSLKMEQK--LK------ 1061
gi 351697812 1029 --------------------IHGNN-----IKD----------------------ASKTRKDSAKRRRQEppVTg----- 1056
gi 884897788  897 kdaseprqdstpsktqlpdqV-PPKck-isDKD----------------------ACGKKCGALANEGQE--LNg----- 945
gi 637299515 1321 --------------------MQSDR------------------------------TLNKISGHTKAKENKpyTRdqtapp 1350
gi 565306628 1328 --------------------DQSNKaltktFGC-------------------------KETEPQVKEDKLpkLEqantpc 1362
gi 971372218 1337 --------------------IQKNKedvckYIS----------------------VTNKKSK--MNNEPKplSPqlekng 1372
gi 733870716 1428 --------------------IQKNKkdvckYTS----------------------VTNEKSK--MNNEHKplSPqlekig 1463
gi 564349878 1008 --------------------MHGDKtkgskTKDsreeqqhfs----akcykkdkdNLKMRHDSSLKMEQK--LK------ 1055
gi 514792775 1364 --------------------VHKNKkdackYTA----------------------VMTKKARLQMDDEQKplPKeaekvr 1401
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1278 QFSSKCDK-LNPLQNHKRK-KLRFHeVTFHSSNKMtaSYEQASQETRQKKHVTQNSRPLKTKTAFLP------NKDVYKK 1349
gi 156630980 1062 NISSKCDI-PNPSKCNKIAaPEILH-VTTSNSAKNmpFSKQASQESLQKKHTSQDLGPVKAPIELSS------NTDPCRS 1133
gi 351697812 1057 QFSSKCDE-PDPLQRNKKV-KLKFHeVKFQSGDKMt-LSDQTSQEGLQKKHASQNSYPLTPKTSLFP------NTGLHRE 1127
gi 884897788  946 QLSSKDSK-LGSSQRNKGV-KLKFHeVKFQSSS----PDQASKEEGPLKKHTLQNSDLLDPKVSLFP------SKDPCRK 1013
gi 637299515 1351 LLSSEKLTlLKTEQTNAHLeKELSHdAPSQPLKTEm----EAVEIDVRRDHVDAGRNSFTAEAQHLSnmadviARNLCRS 1426
gi 565306628 1363 YLLEKSDS-----QEPKKRgKKLSHsADSQSLQRE-----RVGTNKMHKKNGRRNISKSEAQYHLNTd----fKKIIIKK 1428
gi 971372218 1373 PLNSSEKQdVNSSKSGNRKeEMQESgRTPLLKKEF--HSDKKDHQKISEGELPEKGGCTGVDSVMKSs-----EKEKIFK 1445
gi 733870716 1464 PLNSSEKQdVNSSKSSNLKeEMQEPrRTPSLKKKF--HCDKKDHQKVSEGELSEKAGCTDTDNMMKSs----kKKERIFK 1537
gi 564349878 1056 NTSSECDR-LNPSKSSKIAtPEILH-VKTSNSDKNmsFFKQASQESLQRKPTSQDSNPVKAPVELPS------NTDPCRR 1127
gi 514792775 1402 PLNSSEKKdLDKSKSSNSKeEPEMCsITPLLGKES--NSDKKDNQKASEEELSEKAGHADVDNVTKSs-----KKERIFK 1474
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1350 HSSLGQSLSPEKIKLKLKSVSFKQ----KRKLDQGNVLDMEVKKK--KHDKQEQK--G-------SVG-AT--------- 1404
gi 156630980 1134 NTSSVQSVSPEKKKLKFKAGGSRLkyfeKRKTDHVIIPDVEIKKK--KYEKQEQN--K-------NAG-DT--------- 1192
gi 351697812 1128 NDSFVQSSSQEKKKLKFKESSPQEghleKRKIDQGERPGLEIKKK--KCDEQEQN--K-------NAG-VT--------- 1186
gi 884897788 1014 NGSYVQSSSek--klKSRESCPQEahfeKRKLEQEEVTGLEMKKR--RSNKEEQN--K-------NTG-VT--------- 1070
gi 637299515 1427 DSSSKQ--RNEKLDVKLKTDADRH-----RPIISKHRTNGERYKI--KWDSSETHmiK---------GpIKslkrkkaie 1488
gi 565306628 1429 FAKKKLEKKSFNKTLKSKTDIDRH-----RGTETKLSANFEKYKI--KRDTSETHmiK-------GPVsSRslkrqmmke 1494
gi 971372218 1446 MKSLSKDKTRTDLAPKSQRDLHKYtkseNVAIKRTEVCQGQERKIcdNNSGKEQNckKr------NVGvNTerkaklspe 1519
gi 733870716 1538 KKSLSKDKTRTDLAMKSQRDLHKYtkseNVAVKHSEVCKGQKRKIcdKNTGKEQNhkKq------NVGtNTegkaklspe 1611
gi 564349878 1128 NTSLVQFVSPEKKKLKFKAGGSRLkyfeKRKTDNMIIPDVEIKKK--KYEKQEQN--K-------NAG-ET--------- 1186
gi 514792775 1475 VDSISKDKTKTGLTMKSRTDIHKCtksdTAAIKHAEAHQGQKKTTcdKNTGEEQNcgKqkdtlgqNVGiNTkekaklaae 1554
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1405 FKLGD----SLSNPNERAIVKEKMVSNTKS---VDTKA-SSSKFSRILTPKEYLQRQK----------HKE-ALSNKASK 1465
gi 156630980 1193 LKLCS----ILTESNERASVQEKTVPSPES---SDPKG-SSSKSTRVITVQEYLQRQK----------DKQ-ITGNNASR 1253
gi 351697812 1187 CKLCN----TLPNPNEKAIAKENSTSNAKSldiKDTRD-GSCKLKKVITLQEYFQRKK----------QKE-VMA-KTAM 1249
gi 884897788 1071 ----YkscdSVPNPNEQAIVRE---STLKS---SDFRNtGerptnrdktasqsqlsnvkdtrervsirqqtvskmqasda 1140
gi 637299515 1489 RKRKA----LAVHHND--DINDSNANGVGS---DLRKH-ENPQCMSTSHSQEHLNVKKciidlekkfgYKKvNYKEPTSS 1558
gi 565306628 1495 KKLKA----LETQPSE--VIPSSTLNTVSF---ASEKH-ENSEHNSTLGSQEHLNKTKlkdle-kqygYKKvQYNEPICP 1563
gi 971372218 1520 IKREK----LNSYHAEAMKFPNLGIRDLKS---SNYTF-SQRNSIKAHPPQEESYKRK----------RKDnLIGKTSSK 1581
gi 733870716 1612 IKREK----LNSYQAEAMKFPNFGIRDLKS---SNYTF-SQHKSKKAHPPQEESYKRK----------RKDnVIGKTSSK 1673
gi 564349878 1187 LKLCS----ALRESNERASVQENAIPSPES---SDSKG-SSLKSTRVITVQEYLQRRK----------DKH-VTGSDASG 1247
gi 514792775 1555 KGQKK----LNSYHTEAMKFPGFGSKDLKS---RNQKY-SPHKSVKAYPPQEESYKRK----------RKD-IIGKRDCK 1615
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1466 KICVKNVPCDSEHMRPSKLAVQ--VeSCGK-SNEKHSSGVQTSKESlnglTSHGKNLKIHH-----SQESKTYniLRNVK 1537
gi 156630980 1254 NICVETVLCDSGHTKTSKHSAA--V-SWGK-LVEGQSISAETAKELehnsSSHGKDFKIHH-----SEASRTHsvSNNNK 1324
gi 351697812 1250 KTCLENVSGNSASSGFAQLHAQ--PeSCRK-SNGKGGSSIETSKDSsnvyTNCGKNLKAHP-----PEESKTCslSRPVE 1321
gi 884897788 1141 kdtreratvrdkavsqtqasqakdtreritaeeqaaqtqvsdakdtrgratvsnktasqtqaacakdtrernsvkeqtaq 1220
gi 637299515 1559 ESTVHRSDSTENHSECTKPKMK--KiNLEKyAYSKDRQNAWKCRSSh---LENNKTLTPQKqrmrpLKASRMF--SPGKE 1631
gi 565306628 1564 KQPV-----EKNLTQLVK------RiNLEKyAYRKDKTNAWKCQSS----HFNNRIPASQNegdnpSNVFEVH--SPVKE 1626
gi 971372218 1582 KTKVEDERLKQSETKNSKRHSYdrKiNTDK-TKKLSGENVWKPKNS----LADRSMLKLQRir-glSTISKNH--FSNKE 1653
gi 733870716 1674 KTKVEDESLKQAETKNSKRHSYdhKiNTDK-TKKLSGENVWKPKNS----LADRSMLKRQRrr-glSTISKNH--LSNKE 1745
gi 564349878 1248 NICVENVLCNSEHMKTSKDSAE--I-SWEK-SADGQSIRAETSKEPghnsTIHGKAFKIHH-----SEVSRTHsvSSNSK 1318
gi 514792775 1616 KTKVEDERLKQSEAKNSKQCSYncMiNTDK-TKKLNGENVWKPRNS----LGDHTMLKLQRkr-grSAISRNY--FSNKE 1687
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1538 EKVGGKQPDKiWIDKTKLDKltni-sneaQFSQMPPQvKDQKKLYLNRVGFKCTERESISLTKLESS-PRKL-----HKD 1610
gi 156630980 1325 GKFDGKQPDKmFKNKTSMNN---------ESNQMPLQvKEQRKQYLNRVAFKCTERESICLTKLDSA-SKKL-----SIE 1389
gi 351697812 1322 GRADAKQLIK-----TKLDKtlsn-----vsneVSSQvKEQRKSYLNRLSFRCTERESICLTTLNSS-PAKL-----GKD 1385
gi 884897788 1221 trasdvkdtqgrttvqersapqtqasdakdgscrlkkvitlqeyfqrkrqngpmaetakkiclenvsgnftstspttdca 1300
gi 637299515 1632 AMLDANKRDK-RVERSLSDKmscf-srrtGKLSLSLH-REPKKTYLNRVAFKRTTHKTICLTNLEPWhSKSDwqvksSSL 1708
gi 565306628 1627 GTLDSSNPDK--SVKSLSDKkcf---krkNKHTIFLQ-KEQKKNYLNRVAFKRTAQKTIHLTSLDSVhSKPLwqmksSNR 1700
gi 971372218 1654 KHLDGQNKDK-CSEKMFSDKnglylnrrtNRLKLHLQ-KEPKKHYLNRVAFKRTAQERIFLTKLETS-PVRPvlhvkSQV 1730
gi 733870716 1746 RHLDGQNKDQ-CSEKMFSDKnllylnrrtNRLKLHLQ-KEPKKHYLNRVAFKRTAQERIFLTKLETS-PVRPvlhvkSKV 1822
gi 564349878 1319 ----GKQPDK--IYKARTSN---------EHSQVPLQvKEQRKQYLNRVAFKCTERESICLTKLDSA-SKKL-----STE 1377
gi 514792775 1688 RHLDGQNKDK-CSEKIFSDKnmlylnrrtNRLKLHLQ-KEPKKHYLNRVAFKRTAQERIYLTKLETS-PVRPvwhlkSKA 1764
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 317373452 1611 --KRQENKHKTflpvkGNTEKSNMLEFKLCPDILLKNTNSVEERKDVKPHPrkEQAPLQVSGIKSTKEDWLKFVATKKRT 1688
gi 156630980 1390 k-KSGEYTSKT-----KDTDKPSMLEFKLCPDVLLKNTSTVDKQDCPGPGPekEQAPVQVSGIKSTKEDWLKCIPTRTKM 1463
gi 351697812 1386 k-KSSEHKPKAsfpgkDSSVKPSMLEFKLCPDVLLKNTNSVEDKYDLKAHPe-EQATAQVSGIKCSRKDWIKCVTEKKVM 1463
gi 884897788 1301 qvescgrlngkggssletlkkssnvcancgkdlkahlaeesktcalwnqvkgradgkqptktkvdktlcnisnemspqsk 1380
gi 637299515 1709 sgSSKDNSKSSsspqkPEEEKLSI-QFKTCPDILFRNPVTEEQALDEENPP--EKGRTPVTAIKSKREDWIMGAPTKRKK 1785
gi 565306628 1701 teDSEPHQKGSsssqmSEAERPQMLEFKMCPEILFRKSTSEEQTLDARKLP--EKNRISVTAVKSKREDWLNYCPVKRRK 1778
gi 971372218 1731 spHSLDSKRDAslsenEKPRKRQVLEFKLCPEILFRNSATDDESLAAKNFL--EKEKTTVAGVKSKKEDWLKYDSVKQKK 1808
gi 733870716 1823 sqHSLDSKRDAslsenEKPGKRQVLEFKLCPEILFRNSATDDESLAAKNFL--EKKKTTVAGVKSKKEDWLKYDSVKQKK 1900
gi 564349878 1378 kkESEAHTLKT-----KNIDKPSMLEFKLCPDVLLKNTSSVDKQDEPEPKK--EKAPVQVSGIKSTKEDWLKCIPTRTKM 1450
gi 514792775 1765 srNSTDSKRVPspsedDKSRKPQVLEFKLCPEILFRNSATDDESLSTKNSL--ASEKTTVAGVKSKKEDWLKYDPVKQKK 1842
                        1370      1380      1390      1400      1410
                  ....*....|....*....|....*....|....*....|....*....|...
gi 317373452 1689 QKDSQ-ERDn---VNSRLskRSFSADGfEMLQNPVKDSKEMFQTYKQMYLEKR 1737
gi 156630980 1464 PESSQ-RDS----ADSRLskRSLSADEfEILQNPVKESNIMFRTYKKMYLEKR 1511
gi 351697812 1464 QEANQ-EIG----VNLRLlqRSTSADGqEVQQNQMKDSRAMFQTYKQLYLQKH 1511
gi 884897788 1381 eqrksylnrvnfrcterericlstftgsswklgkrenqehkptasfpgkdsas 1433
gi 637299515 1786 TEENKsQVDeeipLETAI--KLLERN--ETFGMPLKET--TYETYRKMHLEKS 1832
gi 565306628 1779 TEENEiQVNddipLDTAI--KILEGN--EVFQGSTKDSKATFDTYRKMHLEKR 1827
gi 971372218 1809 LKEIF-TAEdcipLDTAI--QILEGDE-QALHIPIKDSKQMFQTYKKMYLEKK 1857
gi 733870716 1901 LKEIF-TAEdcipLDTAI--EILEGND-KALHIPMKDSKQMFQTYRKMYLEKK 1949
gi 564349878 1451 PESSQ-EIDs---AGSRLskRSFSADEfETLQNPVKDSNVMFRTYKKMYLEKR 1499
gi 514792775 1843 MEGIS-TVEdsipLDTAI--QILEGDG-VALHSPIKDSKEMFQTYKKMYLEKS 1891
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap