Conserved Protein Domain Family
DUF4619

?
pfam15398: DUF4619 
Domain of unknown function (DUF4619)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 128 and 299 amino acids in length.
Statistics
?
PSSM-Id: 317764
View PSSM: pfam15398
Aligned: 12 rows
Threshold Bit Score: 370.336
Threshold Setting Gi: 611971720
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 408360304   1 MGLGHSKAHPRVIKVTPLQSQETETPSTGPVFFALNRNLEEES--SFTRLQDQnRTREGQLPPLRETWYGRLPA---VSR 75
gi 821454926   1 MGSKYSKSHHKVTRVAPMQDKDLMSSPASPVDIIFNENPEEQSlySFARKQEK-KTLDRQLPPLRETLYGRYSSgleISR 79
gi 345313326   1 MGSGSSRTHPKVTQVAPLYSRDAPPPSVGS---AAGGQEEGYSsrTLAGLRGKmGQFERQLPPLRQTGYGCYAT---VPG 74
gi 611971720   1 MGSKHSKAYPRVTKVAPIQDKCPLSSPVNHREVPFIDNLEKRSlyPFAKLQGQ-KKSPKQLPPLRETENGRYSSdlnMPR 79
gi 291403933   1 MGLRHSKSHPRVIKVAPLRNKEEETAPAGPVDFAIKQNLEEKSscSLPRLQDQnKALEGPLPPLRETWYGRYST---VSQ 77
gi 395843364   1 MGLSYSKARPRVTKVAPLQNKEEETPLVGPMDFTVNQTLQGKSspLLARPQDQsKTLEGQLPPLRETRYGRYFA---ASR 77
gi 513019709   1 MGLSYAKAHPGVTKVAPFQSKEAETPSAGPLNFAVHQNLEENNlyLFTRLQDQnRALEGQLPPLRENWYGRYSA---APR 77
gi 114653215   1 MGLSHSKTHPRVIKVAPLQNKEVETPSAGRVDFAFNQNLEEKTsySLARLQDQnKALEGQLPPLQENWYGRYST---ASR 77
gi 311245567   1 MGLSHSKAHQRVTKVAPLQDKEEETPSAGLVDFAFTQNLEEKSscSFSRLQDRnKALEGQLPPLRETWYGRYSAvlhVPR 80
gi 532074277   1 MGRSHSKAHSRVTKVAPLQNKGADTPSAGPMDFAFNHNLEEKSsySLARLQDRnEILNGQLPPLRETWYGRYST---APR 77
gi 344273459   1 MGLGHSKAHPRVTKVAPLQNKGEETPSACPVDFAFSQNLEEKSlySFSTLQDRtKALEGQLPPLRETWYGRYSA---VPR 77
gi 513189842  37 MGLSSSRTHPRVTQVAPMLSGE--------------EVLGGPSlhPTATTQHGhPITHGQLPPLRQTGYGRAST-----G 97
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 408360304  76 AMYLDIPLKHEETSIIKRHPPRRIQKLEPIDlPQAITSERLLCHQEGRTKSNTKqENEKKIQLPMYTSGKRQYLHKMKML 155
gi 821454926  80 PMSVDIPLERGETSIIKRHPPRRFQMLEPLE-PQVNTAEKFLTQKAAETMLKKK-ELEKRMQALTYSSGKRQYLHKMKML 157
gi 345313326  75 AMTLDTSLENRGTSIIKSHPPRRLQVLEPVGpPQ---ARGSLTQHEAAVAPRAK-ELEKRMQSVRHPLGKRQYFHKMQML 150
gi 611971720  80 PMSFDISVEKRETSIIKKHPPRRFQq-----------------------------DLEKKMQSLTYSSGKRQYLNKMKML 130
gi 291403933  78 AMYFDIPLEQGETSIIKRHPPRRPQKLEPIDlPQVITSERLLSQREARTRHTAKqELEKKMQAPTYASGKRQYLHKMQML 157
gi 395843364  78 TMYFDIPLEQGETSIIKRHPPQRLQKLEPMDlPQVITSKRLQSQREAGMVHRAQ-ELEKKMQTPMYTSGKRQYLHKMKML 156
gi 513019709  78 DMYFDIPLEPGETSIIKRHPPQRLQKLQPIDlPQVRTSERLPSQQAARMRPRAKqELEKKMQTPMYTSGKRQYLHKMQML 157
gi 114653215  78 DMYFDIPLEHRETSIIKRHPPQRLQKLEPIDlPRVITSGRLLSQREARTMHKAKqVLEKKMQTPMYTSENRQYLHKMQML 157
gi 311245567  81 AMYFDIPLEQGETSIIKRHPPRRFQKLEPIDlPQVMTSERLLSQQEAARTQKAKqELEKNMQIPTYPSGKRQYLHKMQML 160
gi 532074277  78 AMYFDIPLERGETSIIKRHPPRRLEKLEPIDlPQVITSERLLSQQQTWTRHKAKqKLEKKMQTPTYTSGKRQYLHKMQML 157
gi 344273459  78 AMYFDIPLEKRETSIIKRHPPRRLQKLEPIDlPQVITSERLLSQQEARTTHKAK-------------------------- 131
gi 513189842  98 PLDFNTVLENGASSIIKLHPPRRPQRLEPASaPRGITAAKPWSQQGVDGAPKAK-TLEKRGQSLRALPGRRQHLHKMQML 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 408360304 156 EMNHKRQEAQMELRKSLLSKAML-DMQKLKDHNGNKIAQSKPRSNG---YDILTILPNENINRDPGNPQDEEFLdCHTEN 231
gi 821454926 158 EMNCKKQESQNELKRSLHREARI-NKHKMNELKAKKVLENMPRDDDn--EDFVAMESNIPINEERGNAWNKELM-NHEWS 233
gi 345313326 151 EMNRKRQEAQAELKRNLQRESRI-GKQKARERRGKKPSVNLPGNRGw--EDLATPEPPGALPADWGSPWDGEFGaCQPG- 226
gi 611971720 131 EMNCKKQEAQAELKRNLHKDARI-NK-----HKAKKILENMQKNDSr--KNSMTRKSDVLMNGNKGNEQNREFAkNHEQI 202
gi 291403933 158 EMNRKRQETQMELKKSLHKEARI-SNQKLRDHKAEKILQSVSMDGD---YDLLTTLPEKILNRRLGNIENAEFLkHQARN 233
gi 395843364 157 EMNRKRQEAQMELKKTLPKEMRI-NKQNLRDHKAKKILEGIPRNND---HDLLTMLLNETLTRNPGNSQNAEFLeHHTVN 232
gi 513019709 158 EMNRKRQEAQMELKKSLHREAKI-NEQKPRDHKAKKTLQSVPRNDD---YDIVTMLPEETMNRGPGNSQDAEFLqYQARN 233
gi 114653215 158 EMIRKRQEAQMELKKSLHGEARI-NKQSPSDHKAKKTLQSTPRNDD---YDLLTMLPDEILNRGPGNSKNTEFLkHQAVN 233
gi 311245567 161 EMNRKRQEVQVELKKSLHKEAKI-NKQRQRDHKTKKILQSIPRNDD---GDSLISLPDETLNRSPGNSQNAEFLeHQPRN 236
gi 532074277 158 EMNRRRQEIQMELKKSLHREERVtNKQNLRDHKVKKILQSIPGNED---DDLLTTLPDETMNRGPGNSQAAEFLdYQARN 234
gi 344273459 132 --------AQMELKKNLHREARI-NKQKLREHKAKKILQS-PRDED---HDLLTWLPDETENRSPGNSWNAELLgHQAGN 198
gi 513189842 177 DLTRRRREA--ELKRDPHREAKI-NKQKMEELGSEMGLDTLQRGDSarsQDLIPAEHKQHLNGHLGNRGDEAFAgQHSRA 253
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 408360304 232 DY-YVRKIGKMETWLREQEARGQLFWDSSSSDSDELEKDERRPQALVRTKTEKIPL---YDDFYD-S 293
gi 821454926 234 GY-HPRKSDELRRWSLKQQVQDELFWDSSSTNSDESEKDERKCWTLVRTKTERIPV---FDEFFDqE 296
gi 345313326 227 ----PRQGGEAEPRLVRR-AHRELPWETADSDSDGEAEERKKPRALVRTKTERIPL---WDEFFDqE 285
gi 611971720 203 EY-NPRRSDVLRRWSLKQQVQDEIFWDSSSTSSDDLDKNERKSWGLLRTKTQRIPV---FDELLDqE 265
gi 291403933 234 DY-RTRKIGKMEKWIREQEARGQLFWDSSSCDSDEMGTDEKKPQALVRTRTERIPL---FDEFFDqE 296
gi 395843364 233 DH-CPQKVGKMETWLCEQEARGQLSWNGSSSDSDELGTDEKRPRALVRTRTERIPR---YDAFFDqE 295
gi 513019709 234 YY-CPWKMGKMETWFHEQEARGQLLWDSSSSDS-ELGRDEKKPQPLVRTRTERIPL---FDEFLDqE 295
gi 114653215 234 NY-CPWKIGKMETWLHEQEAQGQLLWDSSSSDSDEQGKDEKKPRALVRTRTERIPL---FDEFFDqE 296
gi 311245567 237 DY-CPRKTGKMETWLHEQEARGQLLWDSSSSDSDELGKFEKKPRALVRTRTERIPL---FDEFFDrE 299
gi 532074277 235 EY-CHRKIGKMEAWLREQEARGQILWDISSSDSDEQGNDDKKPRALVRTRTERIPL---FDEFFDgE 297
gi 344273459 199 DY-CPRKIGKIETWLREQETQGQLFWDGSSSDSDESGKNEKKPRALVRTRTERIPL---FDEFFDqE 261
gi 513189842 254 GLpLGGSSSKVGLWFCKEPRSRDLLWDTSSTDSEDWDREEKK---LYR----RRPLthgMNVMFDvQ 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap