Conserved Protein Domain Family
FLYWCH_N

?
pfam15423: FLYWCH_N 
FLYWCH-type zinc finger-containing protein
This family is the N-terminus of some FLYWCH-zinc-finger proteins, found in eukaryotes. The family is found in association with pfam04500. There are two conserved sequence motifs: EQE and QEPS.
Statistics
?
PSSM-Id: 317781
View PSSM: pfam15423
Aligned: 12 rows
Threshold Bit Score: 146.529
Threshold Setting Gi: 300069045
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 166217021   1 MPLPEPSEQEGESVKAGQEP-S---PKPGTDVIPAAPRKPREFSKLVLLTASDQDEDGVGSKPQEVHCVLSLEMAGPATL 76
gi 66840148    1 MPLPEPSEQEGESVKAGQEP-S---PKPGTDVIPAAPRKPREFSKLVLLTASDQDEDGVGSKPQEVHCVLSLEMAGPATL 76
gi 831227291  12 MPLPEASEQEGESMNASQEPlS---LELVTDEIPAATKDPEEFPEYVLLTVCNPDGDEMDTEPKEVHCIMSLEMSDPATF 88
gi 300069045   1 MPLPEPSEQEGESVKAGQEP-S---PEPGTEVVPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGVPGPATL 76
gi 351700243 131 wtkSESCEQE--SLKSDLEP-S---LKPGMDVVPAVPRNPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGAPGPATL 204
gi 562870128   1 MPLPEPSEQEGESVKAGQEP-H---PEQATDIVPAAPRKPRKFSKLVLLTASPQDEGGVGSKCKGVPCVMSLEMSSPTAL 76
gi 989961017   1 MPLPEPSEQEGESVKAGQEP-SpesPETGTDVVPTAPTKPKEFSNLVLLTTSTENGNGVGAQPKGVHCVMSLEMSGPDTL 79
gi 532104474   1 MPLPEPSDQEDESVKAGQEP-S---PDVGTDVVPAAPGKPQEFSNLVLLMASDQDGDGVD-KPTEVHCIVSLEMSGPETL 75
gi 513006599   1 MPLPEPSEQEGESMKAAQEP-S---PETSMDVVPADPSEPQEFSNLVLLTTSDQQGLEVDSDPTEVHCVISLEMVDPSTL 76
gi 358418829   1 MPLPEPSEQEGESVKAGQEP-SpepPEPGTDVVLEAPTKPMEFSELVLLAASTESGDGMDTQPEEVHCVLTLEMADPDTL 79
gi 927108834   1 MPLPEPSEQEGESVKAGQEP-CpesPEPGTDVVPEAPTKP-KFSKLILLVASD-SGDGED-------CVMSLEMSDPDAL 70
gi 859786495   1 MPLPEPSEQEGESVKAGQEP-SpesPEPGTNVVPVAPTKPQEFSELVLLTASTESVDGVDSQPEGGHCVLSLEMSSPDAL 79
                         90       100       110
                 ....*....|....*....|....*....|..
gi 166217021  77 ASTLQILPV-EEQGGVVQPALEMPEQKCSKLD 107
gi 66840148   77 ASTLQILPV-EEQGGVVQPALEMPEQKCSKLD 107
gi 831227291  89 ASTLQILPA-EEQGSIVQPAPPVSEQRYNKLD 119
gi 300069045  77 AKAL--LQIhPEAQRAIEAAPQEPEQKRSRQD 106
gi 351700243 205 AKAL--LKThPEAERAIKAAPQEPEPKHSKLD 234
gi 562870128  77 ASPLQILAA-EEQEGTVQRGPGAPEQKCSELD 107
gi 989961017  80 ARTLQILPA-EEQGGAVQPSPQAPEQKRNKPD 110
gi 532104474  76 ASTLQILPAeEEQALVVQPSLRAPEQKRSKLD 107
gi 513006599  77 ASTLQILPA-EEQVQAVQPCLWSSGLKRSKVE 107
gi 358418829  80 AGTPQILPV-EEQCGVVQPRPQTQAlkpskpn 110
gi 927108834  71 AGTPQILPA-EKQGEAVQPSPQAPEQNHSKPD 101
gi 859786495  80 ARTPQILSV-EEQVGAVRPTPQAFEQKHNKSD 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap