Conserved Protein Domain Family
DUF4629

?
pfam15442: DUF4629 
Domain of unknown function (DUF4629)
This domain family is found in eukaryotes, and is approximately 150 amino acids in length. There are two conserved sequence motifs: MHML and LGKK.
Statistics
?
PSSM-Id: 317796
View PSSM: pfam15442
Aligned: 27 rows
Threshold Bit Score: 134.411
Threshold Setting Gi: 620942739
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81908682    296 PSDQVKKKDHEAPELTDGAPQAKIPNWD---PVEGE-GVIASVGVSDRAIDNMAKDSEGRAPKVSPIRPIRARGQGQDKT 371
gi 861501274   334 lSPMVRKKKYKASEPITGAPEAKMQLKApesLSGEE-GCILTAAASDRAPVDTGENSYRKSPMTASSRTNQDKGYGKGRA 412
gi 884920331   212 PSPQVRKNKHKASSLITEAPAGKVQLKTpegLLKGE-ELICSEDTRDRTSMDMAELKNNKPLSVAFGRTNQANGGGKTRT 290
gi 620950779   507 sfgrsRKHKHKSTEKAPETPKPEVHSMSsqiGEPAFlVSPTKSPGSGCFPQRPKPPKTPKAKKSKAKRPR------LEEP 580
gi 351710208   438 PSAKVRKKKHQASEAITGAPEAKLQLMDlksLSGEK-GCIFSAAASDRAPKDTVEKSYRTSPMMPSNRTNQDEGHGKGRT 516
gi 884927290   400 pcpqGRESKRKASGPMAVAPEAKIHVKEkdsQLGGP-EGLCSVVASGRAPEGNTEKTPRKSPRGTSGRPNQDKGCGQARA 478
gi 514480269   467 ekcQGRASKHKAPEPMAVAPEAKIQVKDkdsQLGGP-EGLCSVVASERAPEDNTQKRHRKSPRGASGRPNQDNGGGQAWA 545
gi 344256437   395 tYKEVHRNDQKASDLLRGVPQARIQCQV---LLEGE-EALGIARASEGAIDNMAKHLDGTAQKYAHSRPRIFRAQGQDKT 470
gi 1032954562  465 PSDQVRKGNQNASELLDGAPQVKNQCQD---VVEGE-GAEGSARASEGAIDNMAKHLDGTAQKSAHSRPRISRAQGQDKN 540
gi 611985597   537 PSDPAKKTKRKIPELMATLPAAKALPRNpdcLLAGDmAAVSGSGASELSPLDVAKSASSKSRKAPSSRASKTKGSSQEKM 616
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81908682    372 KWTrENNSKKTEEPKQSRNRVKAEEKPTVPKTKIKRDPPELSRTSFKKPRTHLGMHMLESVQVFHPLGKK 441
gi 861501274   413 ERTkSNNGKKAPERKQSGPKVKVEEMPTIPNRNHKRHQPVTGQEVFKRPRTSLSMHMLESVQVFHPLGKK 482
gi 884920331   291 KRTrENKSKKMPERKQLGLKLKEEERPNISNSKRKRRQPALGQDVFKVPRTCLGMHMLESVQVFYPLGRK 360
gi 620950779   581 EDLgGSNSELTGGKAQSKINAMSEEQSPFFKRKRRNDYPEFSQEPFKKPRSNLGMHMLQSVQVFHKLGKK 650
gi 351710208   517 KRAkGNNGKKALENKQSEPKVKAEEMPTIPNRKRKRQQPGTGQEVFKMPHTRLGTHLLESVQVFHPLGKK 586
gi 884927290   479 KKT---NRKKVAERRQPTPQIKAKDKP-IANTKRKRQPPVLGQESFKMPRTSLGMHMLESVQVFHPLGKK 544
gi 514480269   546 KKT---NRKK-------------TKDKSIVNMKRKRQAPVLGQESFKMPRTCLGMHMLKSVQVFHPLGKK 599
gi 344256437   471 KRTrENKTKKSGKLKPSCSRVKVEDKLSILKTKRKRNPPEFSQGSFKKPRTHLGMHMLEAVQVFHPLGKK 540
gi 1032954562  541 KRTrENKTKKKGELKPSCPRVKAEEKPTIPKTKRTRNPPELSQDSFKKPRTHLGMHMLESVQVFHPLGKK 610
gi 611985597   617 EGTgDTGYEKVEGNELPGGRAKPEEKPALPKMKRKKNHPELSQEAFKKPRSFLGMHMLESVQVFHALGKK 686
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap