Conserved Protein Domain Family
ATS

?
pfam15445: ATS 
acidic terminal segments, variant surface antigen of PfEMP1
ATS is the intracellular and relatively conserved acidic terminal segment of the Plasmodium falciparum erythrocyte membrane protein-1 (PfEMP1). this domain appears to be present in all variants of the highly polymorphic PfEMP1 proteins.
Statistics
?
PSSM-Id: 317799
View PSSM: pfam15445
Aligned: 25 rows
Threshold Bit Score: 623.752
Threshold Setting Gi: 74815613
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74815131 2097 TIPFGIALALGSIAFLFLKKKTKSTI-DLLRVINIPKSDYDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDS--GYT 2173
gi 74863466 1753 TLAWSVGIGFAAFTYFFLKKKTKASVgNLFQILQIPKSDYDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDS--GYT 1830
gi 74815269 1631 TIMWSIGIGFAAFTYFFLKKKTKSSVgNLFQILQIPKSDYDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDS--GYT 1708
gi 74866884 1746 AFPWTVGVAFMALSYWVMKKKSKPRV-DLFSVMEIPQNDYGMPTLKSKNRYVPYSSGKYRGKTYLYVEGDSGTDS--GYT 1822
gi 74815611 1743 TIMWSIGIGFATFTYFYLKKKTKSSVrNLFQILQIPKGDYDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDS--GYT 1820
gi 74862669 2168 TIPFGIALALTSIALLFLKKKTKSSVgNLFQILQIPKSDYDIPTPKSSNRYIPYVSDTYKGKTYIYMEGDSSGEEkyAFM 2247
gi 74862561 1807 TIMWSIGIGFAAFTYFYLKKKTKHPV-DLFSVINIPKSDYDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDS--GYT 1883
gi 74815570 1671 AFPLSVGIAFVALSYFVLKKKTKASVgNLFQILQIPKSDYGTPTPKSKNRYIPYVSDRYKGKTYIYMEGDSSGDEkyAFM 1750
gi 74815268 1747 TIMWSVGIGFAAFTYFYLKKKTKASVgNLFQILQIPKGDYDIPTLKSSNRYIPYASDRYKGKTYIYMEGDSSGDEkyAFM 1826
gi 74815613 1700 SFPLTVGVAFAALSYFLLKKKSKSTI-DLLRVIDIPKGEYGIPTSKSKNRYIPYASDRYKGKTYIYMEGDESDDy--TYI 1776
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74815131 2174 DH--YSDITsSSESEYEELDINDIYAPRAPKYKTLIEVVLEPSGNNTTAsgnnttasgnntt----asgnnttasdtqND 2247
gi 74863466 1831 DH--YSDITsSSESEYEEMDINDIYAPRAPKYKTLIEVVLEPSKRDIPS-----------------------------DD 1879
gi 74815269 1709 DH--YSDITsSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSGNNTTAsgknt-------------------psdtqND 1767
gi 74866884 1823 DH--YSDITsSSESEYEELDINDIYPYQSPKYKTLIEVVLEPSKRETNS-----------------------------GD 1871
gi 74815611 1821 DH--YSDIT-SSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKSNGNT------------------------------- 1866
gi 74862669 2248 SD--TTDVT-SSESEYEELDINEIYPYQSPKYKTLIEVVLEPSGKNTTAsgnnttasg------------kntpsdtqND 2312
gi 74862561 1884 DH--YSDITsSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSGNNTTAsgnntta---------------sgnnttaSD 1946
gi 74815570 1751 SD--TTDVT-SSESEYEELDINDIYAPRAPKYKTLIEVVLEPSGNNTTAsgknttasgktqsgnnttasgkntpsdtqND 1827
gi 74815268 1827 SD--TTDVT-SSESEYEELDINDMYVPGSPKYKTLIEVVLEPSKRDTMSt---------------------------qSD 1876
gi 74815613 1777 GDisSSDIT-SSESEYEDIDINNIYPYKSPKYKTLIDVVLEPSKRDTFNt---------------------------qSD 1828
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74815131 2248 IQNDGIPS----------------SK-ITDNEWNTLKDEFISQYLPNTEpN---NNYRSgNSPTN--TNItTTSRH-NME 2304
gi 74863466 1880 IPNNDTPS----------------SK-ITDNEWNTLKHDFISNMLQNTQ-NtepNMLGY-NVDNN--THP-TMSRH-NVE 1936
gi 74815269 1768 IQNDGIPS----------------SK-ITDNEWNTLKDDFISQYLQSEQpKdvpNDYSSgDIPFN--TQPnTLYFD-KPE 1827
gi 74866884 1872 IPNDNTPA----------------NKpITDEEWNTLKDEFISNMLQSTQ-NtepNILHD-NMHYN--THPnTLYFD-KHE 1930
gi 74815611 1867 LGDDMVPT----------------TNtFTDEEWNELKHDFISNMLQNQp-----NDYKSeDIPLN--TQPnTLYFN-KPE 1922
gi 74862669 2313 IQNDGIPSdtpntpsdipktpsdtPPpITDEEWNQLKHDFISNMLQNTQ-NtepNMLGY-NVDNN--THP-TPSRH-TLD 2386
gi 74862561 1947 IPSDNTPT----------------PQpITDDEWNTLKDEFISQYLQSEQpNdvpNDYTSgNSSTN--TNItTMSRD-NVD 2007
gi 74815570 1828 IQNDGIPSsdi-----------phTNkFTDDEWNTLKHDFISNMLQNEP-NtepNILRD-NVDNN--TNP-KTLHV-SMD 1890
gi 74815268 1877 IPLNDKLD----------------SNkLTDEEWNKLKQDFIS-ILQNPQ-NdlpQNNISgNIQMD--THPsVSILHdDME 1936
gi 74815613 1829 IPSDTS------------------TNkFTDNEWNQLKQDFISNILQSTQ-MdlpNENIIdDF-MDkgIQPnNPVLDvNMA 1888
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74815131 2305 EKPFITSIHDRNLYTGEEISYNIn--------MSTNSMDD---------------------PKYVSNNVYSGIDLINDTL 2355
gi 74863466 1937 EKPFIMSIHDRNLLNGEEYSYNV---------NMVNSMNDi--------------------PMSGKNDVYSGIDLINDSL 1987
gi 74815269 1828 EKPFIMSIHDRDLYSGEEYNYNVn--------MSTNSMDDi--------------------PINSHNNVYSGIDLINDTL 1879
gi 74866884 1931 EKPFIMLIQDRNLLIREEYSYNM----------STNSGGNgsysgispisdnpdslsdkngPTSGNHNLYSGTDLINDAL 2000
gi 74815611 1923 EKPFITSIHDRNLYSGEEYSYNIn--------MSTNSMDDi--------------------PINRDNNVYSGIDLINDTL 1974
gi 74862669 2387 QKPFITSIHDRNLYTGEEYNYNVn--------MSTNSMDD---------------------TKYVSNNVYSGIDLINDSL 2437
gi 74862561 2008 EKPFITSIHDRDLYTGEEYNYNIn--------MSTNSMDD---------------------PKYVSNNVYSGIDLINDSL 2058
gi 74815570 1891 EKPFIMSIHDRNLYSGEEYSYNVn--------MSTNSMDD---------------------RQYVSNNVYSGIDLINDSL 1941
gi 74815268 1937 EKPFITSIHDRDLHNGEEVTYNInlddhknmnFSTNHDNIp--------------------PKNNQNDLYTGIDLINDSI 1996
gi 74815613 1889 EKPFITSIHDRDLHNGEEVTYNInfdvskninEITNTTDD---------------------SKYVSNNIYSGIDLINDSL 1947
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74815131 2356 -SGNKHIDIYDEVLKRKENELFGT-NHTKKnTSTNSVAKLTNSDPIHNQLELFHKWLDRHRDMCEKL-KN-DNERLAKLK 2431
gi 74863466 1988 -SGGEPIDIYDEVLKRKENELFGT-NHVKQ-TSIHSVAKPISDDPIHNQLELFHTWLDRHRDMCEKW-EN-HHERLAKLK 2062
gi 74815269 1880 -SGNKHIDIYDEVLKRKENELFGT-NHVKQ-TSIHSVAKLTNSDPIHNQLELFHKWLDRHRNMCEKW-EN-HHERLAKLK 1954
gi 74866884 2001 -SGD--YDIYDEMLKRKENELFGT-NHTKH-TTTNRVATQICDDPITNQLNLFHKWLDRHRNMCEKW-EN-HHERLDKLK 2073
gi 74815611 1975 -SGNQHIDIYDEVLKRKENELFGTkHHTKR-TSTQNVAKPARDDPIHNQLDLFHKWLDRHRDMCKKW-NN-KEGLLDKLK 2050
gi 74862669 2438 nSGNQPIDIYDELLKRKENELFGT-NHPKH-TNTHNVTKSSNSDPIDNQLDLFHTWLDRHRDMCEKL-KN-DNERLAKLK 2513
gi 74862561 2059 nSGNEHIDIYDELLKRKENELFGT-ENTKR-TSTYSVAKNTNSDPILNQINLFHKWLDRHRDMCETL-KN-DNERLAKLK 2134
gi 74815570 1942 nSNN--VDIYDELLKRKENELFGT-NHVKQ-TSIHSVAKPISDDPLLNQLELFHKWLDRHRDMCEKW-EN-HHERLAKLK 2015
gi 74815268 1997 -SGNHNVDIYDELLKRKENELFGT-NHTKH-TTTNSITKKTHNDPIVNQINLFHKWLDRHKNMCEQWdKHkKEELLDKLK 2073
gi 74815613 1948 -NSDQHVDIYDELLKRKENEIFGT-NHTKH-TTTNSIAKQTHTDPILNQLDLFHKWLDRHRNMCEQWnKNkKEELLDKLK 2024
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74815131 2432 EEWENET--HSgdinsgipsgklsdipsdnnihSDIHPSDihsgklsdipsGKQ-------VLNTDVSIQIHMDNPKTTN 2502
gi 74863466 2063 EEWENET--HS----------------------GNTHPSD-----------SNK-------TLNTDVSIQIHMDNPKPIN 2100
gi 74815269 1955 EEWENET--HS----------------------GNTHPSD-----------SNK-------TLNTDVSIQIHMDDPKPIN 1992
gi 74866884 2074 ELWDNET--HSgnkhngi---------qsnipsSDIHPSDihsgklsdtpsDNNihsdipyVLNSDVSIQIHMDNPKPTN 2142
gi 74815611 2051 EEWNKDT--NSgk------------------lsDNIHSdnkpg----dipsDNH-------VLNSDVSIQIDMGNPKYIN 2099
gi 74862669 2514 EEWENET--HS----------------------GNTHPSD-----------SNK-------TLNTDVSIQIHMDNPKPIN 2551
gi 74862561 2135 EEWENDTs-TS----------------------GNTHPSD-----------SNK-------TLNTDVSIQIDMDNPKPTN 2173
gi 74815570 2016 EKWENET--HS----------------------GNTHPSD-----------SNK-------TLNTDVSIQIDMNNPKTTN 2053
gi 74815268 2074 KEWEQDYnnNS----------------------DDIHTSDnni-----vstVNH-------VFNTDVSIQIDMDDPNPVN 2119
gi 74815613 2025 EEWNKKNnnNS----------------------DLTHTSsnips---gensIKN-------VLNTDVSIQIDMDDPKPIN 2072
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74815131 2503 EFtyvdsnpnqvddTYVDSNPDNSSMDTILEDLEK-YNEPY-YDV-QDDI-YYDVH-DH---------DASTVDSNAM-D 2567
gi 74863466 2101 EF------------TNMDTYPENSTMDTILDDLDK-YKEPY-YDV-QDDI-YYDVNdDN---------DISTVDSNNM-D 2154
gi 74815269 1993 QF---------------------TNMDTILEDLEK-YNEPY-YDV-QDDI-YYDVN-DH---------DTSTADSNAM-D 2036
gi 74866884 2143 ED------------NVVDCNPv------------------------GNNI-YVDNNpNQtf-----psNPNPVENNTYvN 2180
gi 74815611 2100 QF------------TCVDSNPNL----TLRSNPNLmGNQNPnLNLvENNI-------NPnhqnqnqvgDTNFVDTPTN-- 2154
gi 74862669 2552 EFtyvdsnpnqvddTYVDSNPDNSSMDTILEDLEK-YNEPYyYDMyDDDI-YYDVN-DH---------DASTVDSNNM-D 2618
gi 74862561 2174 EFtyvdsnpnqvddTYVDSNPDNSSMDTILDDLEK-YNEPY-YDMyDDDI-YYDVNdDN---------DISTVDTNAM-D 2240
gi 74815570 2054 EFtyvdsnpnqvddTYVDSNPDNSSMDTILEDLDKpFNEPYyYDMyDDDI-YYDVN-DH---------DASTVDSNNM-D 2121
gi 74815268 2120 PF------------TNMYTNSDNSTMDNILNGMEK-HREPYfYDIyEDDItYFDID-DEktpmgdiyvDHNNVNSNNM-D 2184
gi 74815613 2073 EF---------------------TYMDNIIDNLEK-NSEPY-YDIdEDDIiYFDID-DEkt-----pmYHNNMDNNKS-N 2122
                        570       580       590
                 ....*....|....*....|....*....|.
gi 74815131 2568 VPSKVQIEMD-VNT--KLVKEKYPISDVWDI 2595
gi 74863466 2155 IPSKVQIEMD-VNT--KLVKEKYPIADVWDI 2182
gi 74815269 2037 VPSKVQIEMD-VNT--KLVKEKYPIADVWDI 2064
gi 74866884 2181 APTNVQIEMD-VNNh-KVVKEKYPISDMLDI 2209
gi 74815611 2155 -PTNVQIEMD-VNT--KLVKEKYPIGDVWDI 2181
gi 74862669 2619 VPSKVQIEMD-VNT--KLVKEKYPIADVWDI 2646
gi 74862561 2241 VPSKVQIEMD-VNT--KLVKEKYPISDVWDI 2268
gi 74815570 2122 VPSKVQIEMD-INT--KLVKEKYPIGDVWDI 2149
gi 74815268 2185 VPNKVHIEMNiVNNkkEIFEEEYPISDIWNI 2215
gi 74815613 2123 VPTKVQIEMNvINKq-ELFQEEFPISDIWNI 2152
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap