Conserved Protein Domain Family
Retinal

?
pfam15449: Retinal 
Retinal protein
This family of proteins is found in the photoreceptor cells of the retina. Mutations of the gene encoding this protein have been associated with retinal disorders such as retinitis pigmentosa and late-onset progressive retinal atrophy. The function of this family of proteins is unknown, but it is likely to be important in the development and function of the retina.
Statistics
?
PSSM-Id: 317802
View PSSM: pfam15449
Aligned: 17 rows
Threshold Bit Score: 1488.13
Threshold Setting Gi: 620960840
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926     1 MGCTPSHSDIVNSVAKSGIQFLKKPKAIL---PGRQGasergsIPLLVKNSSCYDTGGSLRQGRE-------PTGEHPGS 70
gi 971386153     1 MGCTPSHSEIVNTLARSGLKALNKPKGVLridPTDKG------IPLLVKGSSCYSIDELHQYGVQrndclieTKEKTSER 74
gi 514713743     1 MGCTPSHSEIVNTLARNGFKALNKPKGVLridPADKG------IPLLVKGSSCYNIDEFH-------------------- 54
gi 821459789     1 MGCTPSRSDIV---SRSGIQFWRKPKAIL---SVHQAccerlsIPLLVQNSTYYGNGEAAPGGWRq------QAREHPDP 68
gi 344280260     1 MGCTPSHSDIVNSIAKNGIQFLKKPKVIL---PGRQEdnercsVPLLLRSPTCPDSGSGQPQGQR-------PAEEQPSS 70
gi 351712971     1 MGCTPSHSDIVNSVAKSGIQFLKKPKEVL---PGHQGsrkkgsAPWLVKSSTCLDAVESLSQGRR-------LAEELPSS 70
gi 532073469     1 MGCTPSHSDIVNNLTKSGVQFFKKPTVIL---PGCHRrsgrgsIPLLVQCSTCYDTWGGLPQGQR-------PAEEQLSS 70
gi 344242222     1 MGCTPSHSGIVNSVAKSGIQFFKKPKAIL---PGCQRgspkcpIPLLVQSSTFCDPGEDLHLGQR-------PAEEPASS 70
gi 564306826     1 MGCTPSHNVIVNSVAKSGIQFFKRPKAIL---PGCQWgsqkcpIPLLIQSSTFCDPGGELHPGAR-------LAEETASS 70
gi 1040209164      --------------------------------------------------------------------------------
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926    71 RRSQTKAKGLCQLM-------------------------------GDPASCKRKDVEGRSPENKTsPSQLNKSHSRTAKG 119
gi 971386153    75 DKNDHLQFSSNSHP-------------------------------NVPISGEDKVIERTATEAEV-ISKLIESQKHITEA 122
gi 514713743    55 -----------QYKiqrnsslseteeklseqdksdylqfsskshsDPHISREDNITERKATGAEV-MSKLIESQKHIIEA 122
gi 821459789    69 KRNQNMVKSLHLFP-------------------------------GNPSPGRRRDA---TLDDEVaLSETMDSQKHLTKD 114
gi 344280260    71 KWNQTTTEGLCQLT-------------------------------GNPASGKRKDMEGWILEAKTsPSQLTKSQSHTAKD 119
gi 351712971    71 KRTQTAAEGLCQLL-------------------------------G--------GMEGLMPETQT---------SHVAED 102
gi 532073469    71 RKSQTTAEGLGQPL-------------------------------G--------DMEGLISETRTsPSWLNKPQSHT--- 108
gi 344242222    71 KKLQTMAEGLCQLT-------------------------------K--------DMKGLIPESQI--LQLNKSQSHAAMD 109
gi 564306826    71 RKLPDMTEGLCQL-----------------------------------------------PESQT--FHMNKSQSRMATD 101
gi 1040209164    1 -----------------------------------------------------------------mgctpshthivnsva 15
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   120 VPLKTQGSHRSQGAACSGEESEE-----TSKWERKPESHRSSKQCHCCQT----PLPALGSEGKVDFPEPLVQAHQRTYA 190
gi 971386153   123 IQIRKQSSCESEASAFISDNKNEsnakqILKKGKKSKNHKTAKQGRPSKTkekaILSPCETEKKVDFPELLVKAHQSAYA 202
gi 514713743   123 VQIRKQSSCESEASASICDDKNEsnakqILKKGRKPKNHKLAKQGRPSKTkkksILSPCEIEKKVDFPELLVKAHQNAYA 202
gi 821459789   115 THLESQNSSRGD---FCWDENKEqsareFSKKGIVPTAHILGKDSCYCQAq---DFLAYGPEDKVNFPEALVKAHHKAYA 188
gi 344280260   120 ILFKTQNSHRSQGTPFSVELSEAsntqeTSTQERKPKCHRLGEQGHRSQT----VLPPHGSAGRVDFPEPLVKAHHDTYT 195
gi 351712971   103 IPFNTPGSHGTHGAAFPGKESVQsttqeTSR------------PGHCCQT----IPPAPGSAGKVDFPEHLVKAHQHAYT 166
gi 532073469   109 -PFQTKGTHGTQGAAFPREESMEsttqeTSRWERKPKCYCSSKQGHCSQT----ILPTPESEGKVDFPEPLVKAHQHAYT 183
gi 344242222   110 MSFRTGGYHTTQEADFAGQEREEnisqeTSKWDKKPMCHQSDNQDQCYQT-------TPESKGKVDFPEPLVKAHQHAYA 182
gi 564306826   102 ISFRTEGSHRTQEVEFSGKEGKEntpreTSERGREPKCHPSDSQDHCCQT-------VPEPKGKVDFPESLVKAHQHAYA 174
gi 1040209164   16 ksgiqflkkpkgilpgrqgdsergsipllvrsstcydsggdlscrptlaeaqpkhrtqttaqGKVDFPEPLVKAHQHAYA 95
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   191 YLHSSLSKYEAILCIMRQATQTRELLQPMLSFLLLCSEEVSQLLGEISKDGEVLLQEVKEDLAWPSRKGEPWEQPDLLQQ 270
gi 971386153   203 YLNPNLSKYEAILHMADQAAQTQLFLQQMVSFLVLRFDEINQLLEEIANDGENLLKDVGGNLAWPSEKGDLKEHPDLLQQ 282
gi 514713743   203 YLNPNLSKYEAILHMANQAAQTQLFLQQMVSFLMLRFDEINQLLEEIANDGENLLKDVGRYLAWPSGKDDLKEHPDLLQQ 282
gi 821459789   189 FLHPSLSRYEAILGIAYEAAQTQQYLQQMVGFLLWRFDEINKLLRDMANDGEVLLQEAGAHLAWPAKKEDAPWQPDLLQQ 268
gi 344280260   196 YLHSSLSEYEAILRIVHQAAQTQELLQPMVSFLLLCFDEVNQLMGKISKDGEALLQEVRADLAWPLKEGEPQEQPDLLEQ 275
gi 351712971   167 YLHSSLSKYEVILCLIHQATQTRELLQPMLHFLLLCFEEVTQLLGEISRDGEVLLQELRDDLAWPSRKGKPQEQPDLLQQ 246
gi 532073469   184 YLHASLSKYEAILHLVQQASQTQGLLQPMLSFLLLCFEEVGQLLGEISKDGEVLLQEVREDLAWPLKKGEPQEQPDLLQQ 263
gi 344242222   183 YLHTSLSRYEAILQLVQQASHTRELLEPMLSFLLLCFEEVSQLLGEISKDGEVLLQEVRGDLAWPSGKGEPWEQPDLLQQ 262
gi 564306826   175 YLHTSLSRYEAIVHLVQQASQTWELLQSMLSFLLLGFEEASQLLGEISKDGEVLLREVRGDLAWPVRKGEPWEHPDLLQQ 254
gi 1040209164   96 YLHHSLSKYEAIVCLVQRATQTRELLQPLLGFLLRCFEEVSQLLGEIAKGGEELLQEVREDLAWPLGKGEPREQPDLLQQ 175
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   271 LLQYTVSKLQALNGTVAALTGSCLEGSSSYLHSAASHLENKLSLKRSMDERLLRALGQLESLASSHSDPGVQGPPLCSED 350
gi 971386153   283 LLQYTINKMQLLNGTLASLTSDALQETCNYLQTAASNLEGKLKAKQMFDERLLQTVRLLEASTMGNTQYHGDDRTLCSED 362
gi 514713743   283 LLQYTINKMQLVSGTLASVTSDALQETCSYLQSAASNLEGKLKAKQSYDERLFRAVRLLEASTMGSSQSHGDDRTLCSED 362
gi 821459789   269 LLQYTANRMQVLHDTVTTLTSSSLQDSSSYLHSAAQHLDKKLETKRELDQCLLKAIGLLKGCVAGPGTPKVDDRPLYSED 348
gi 344280260   276 LLQYTISKLQGLRGTVDSLTCSLLEGSSSYFHSTASRLEKKLSIKRGMDEHLLRVLGQLENLASGHGDPGVQGLPLFSED 355
gi 351712971   247 LLQYTVSKLQVLHGMVASLTGSFLEGSSGYFYSTATHLGNKLSTKRGVEERLLRALVQLESLASGHGDPGLQDLPLCSED 326
gi 532073469   264 LLQYTVSKLQVLHGMVAALTGSFLESSSSYFHSTASRLENQLSTKRSVDERLLRALRQLESLASGHGDPGLQDLPLCSED 343
gi 344242222   263 LLQYTVNKLQVFHSTVAALTGSLLEGSSSYLNSTASHLEGKLSTKRGIDECLLRALGQLESLTTGHGDPGLLGPPLCSED 342
gi 564306826   255 LLQYTVNKLQVVHSTVAALTGSFLEGSSSYLRATAGHLEGKLSTKRGIDECLLRALGQLESLTSGSSDPGLLGPPLCSED 334
gi 1040209164  176 LLQYTVGRLQALHGTVASLTGSSLEGCHHSLHSTASHLETKLSTKRGVEERLLRALGQLESLAGGRGDPGLQGLPLCSED 255
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   351 SGIGADNESLQS---VDKLAKQNSWDCvpepteWKPGTPPPVETRPPGQAwQHGPSWLGSDRPQDCPLSRPPLAKVQPAA 427
gi 971386153   363 SGIGVDSESLKDfspFSQLGAQASFDS------SAHGLLSQKHTRMMEHI-HNGTRPPGTATSHNYALEMHFKDVFHSSV 435
gi 514713743   363 SGIGVDSESLKDfspFSQLGAQASCES------CARGLLSQNHTKTMEHM-HSGTMSPGTATSHGCALEWHFKDTFYSSV 435
gi 821459789   349 SGIGADNESLHS---VDKLGKQSSWDSleepteRKPWVSSHRETKAD--AwLHYPSALGPSRPQDGALER---QRAQPAA 420
gi 344280260   356 SGIGAENESGQS---LDKLGKQTSWDFvlepieQKPVISPQVEARPSGYAwQPSPFWMGSDRPQDCPLSRPPTAKFQPAA 432
gi 351712971   327 SGIGAD-ESVQS---LDKLGKQASWDFtpepieWKLGTSPQMEASLSELAwQQSPFWMGPDRAPGCPLSRAPMSKVQPAT 402
gi 532073469   344 SGIGADNESVKS---MDKLGKQASWNVvpeateLKPGISPQTEARQSGRAwQQSAFWMGSDRPQDCP--RPPIAKVHPTS 418
gi 344242222   343 SGIGADNESVQS---MEKLGRQTSWEFtaepgeWKLGTAPQVEARLAGHAwQKGPYWTGSERHQGCPLSRPRIAKIQPAP 419
gi 564306826   335 SGIGADNESVHS---VEKLGKQASWDFaaelgeWKPGTAAQGEARPSGHAwQKGPYWTGPDRPQDCPLSGPRIAKVQPAV 411
gi 1040209164  256 SGIGGDSESVHS---VDKLGRQGSWDLtpepaeWKSRILPQTEARLPGQAwQQNPCWVGSDRPQDCPLSTPTRAKIQPAA 332
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   428 QGEARGPSPSHL-APGNVTSRPLEPGKSTPSDAFRTGVPAEAHVS-TSSGLMHTVSLSEAEDSS---SEEEDEISs---- 498
gi 971386153   436 QSREGTSCQGGVlEGNSTVAQCASVSKSHSCNSFQSDSTQEHEHF-KVGESIDFPSDDDDDDDEgstLGEDDDNT----- 509
gi 514713743   436 RSREETSCQGGVpGGTSTAAKYASLSKRHSSNSFQSDSTQEGEHF----ESTDFPS----DDDEestLGEDDDNT----- 502
gi 821459789   421 LGN---PSQSDE-ALANSHSRSLQLEKRSSHK--------KGEHS-KDCGLTVPLLLTDEEDGNseeEEEEEEEDseegt 487
gi 344280260   433 KGEAGIQCSSNT-DPESISSGPFWPGKSTPHDSLGIGVPVEACLS-KGSSSMDSPSLSEDEDSSp-dKEEEDEVSs---- 505
gi 351712971   403 QGEARRPCFSST-GPETTTSRPLAVSRSMPQDSLGTTASTKAHLP-KSSRLMATPCLSESEDSSp--EEEDNKVSr---- 474
gi 532073469   419 QGKVRSPGPHST-GPETLTSRPSEASKSAWCDSLGTGIPVEVQLP-KSSRSGEVLPLSESENSSp--DEEEDEVSn---- 490
gi 344242222   420 QANARHSSASST-DPEAVTSRLPEAAKSILQDSLGVETPVQTHFS-QSSGLVDAPSLSEDEDSS---PEEEDEVSs---- 490
gi 564306826   412 QDEARSSNTSST-SPEAVTSRPPEAAKSIPWDSLGTEIPVQTQLSrRSSGLMGSPYLSGDEDSS---PEEEDELGs---- 483
gi 1040209164  333 QREASSPAPCST-SLGKSSPRHLEPGKSRLGKPPRGEGPAEAHPS-KGWEWT-APALSEPEDSS---PEEEEEVGg---- 402
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   499 lNLCAWQQKGPHSRPQSSPANRESPFQS-RPRRLKSPQAREMILKMKESISERIKFVPVPSSHQDWT-EEEEgRPVVPVR 576
gi 971386153   510 -SLSEMGKDALPKRPQSSPAVTDNTQRQ-SIKRTENAEAEEMILKMKDAISEKIKFVPAKSRRKEWM-EDESgTAILTAR 586
gi 514713743   503 -SLSEMGKDALPKRPQSSPAVTDNTQRQsSTKRTENVETEEIILKMKDAISEKIKFVPAKSGRKEWV-EDESgTAVLTAR 580
gi 821459789   488 pSLSHSQRETWFLRPTTSPALTEIMLWP-HFKRIKSPQAHEMILKMKNAISERIKFVPIQPVHKEWM-EDEEkKIILHDR 565
gi 344280260   506 vSLCAWQDTALFPRPQSSPASRESTFQP-HSRRFRNPQAQEMILKMKEAISERIKFVPVPSGPQDWA-EEDDrRTMVPPR 583
gi 351712971   475 mSLCTGQERAPRSRPQSSPADRESPFQP-RSRKLRGPQAQEMVLKMKEAISERIKFVPVPCGHQDWA-EEEEgGTMVLPR 552
gi 532073469   491 mSPCAGLENVSPARPQTSPADWESSFQS-HTRKLRSPQAQEMILKMKKAISERIKFVPAPLAHQDWS-EEEEgRTVVPRR 568
gi 344242222   491 tDLQAEHQKAS-SRPRSSPATWESLFQP-YSKKLRSPQAQEMILKMKEAISERIKFVPVPFGPQDWAeEEEEgRTMVPLR 568
gi 564306826   484 tDLHPEPQKALPSRPQSSPDPRESLFQP-YSTKLRSPQAQEMILKMKEAISERIKFVPVPSRPQDWA-EEEEgRSVVPPR 561
gi 1040209164  403 tIPCTWQEKAPPSRPRSSPASPKSPFQP-HCRRLRSPQAQEMILKMKEAISERIKFVPVPSAHQDWA-EEEDeATAVPPR 480
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   577 PNTVSGGRRAPGRQRRSQSESCIQSQVEDPTLQELRSVQRDLSQRLEAFYAlgaKGQgqsqgqshGQSQEQTQQPR--AL 654
gi 971386153   587 PSTATGRQKAYGKQQRSRSEESLRSQAEDPTLLELQRTQKELSKRLEMFYG---KKE--------TENNKEPWKLRttHF 655
gi 514713743   581 PSTAMGRQKASGKQRRSRSEESLRSQAEDPTLLELQRTQKELNKRLEMFYG---KVD--------TDNNQEPRKPRstRH 649
gi 821459789   566 PSTASEGRTWSEGPKRSKSEESLKNYTEDPTLLELQRVQKDLSQRLEMFYDfrrKRK--------TQNKEE--HPRtaVL 635
gi 344280260   584 PSTVSGSRKAPVRQRRSQSEVSLKSHTEDPTLQELRRVQRDLSQRLEAFYAlgaQRQ--------QHSTEQILKPRaaGL 655
gi 351712971   553 PSTVSVSRRAPERRRRTQSEGCLKSHAEDPTLQELRRVQRDLSQRLEVFYAlgaKRQ--------GQNKEQILLPRaaAL 624
gi 532073469   569 PSTVSGSRRTPERQQRSQSETCLKSHVEDPTLQELRRVQKDLSQRLEAFYAqgpKRQ--------GQRKEQIVRSRgaAI 640
gi 344242222   569 PSTASGSRKAPERQRRSQSEGCLKSHVEDPTLQELRRVQTDLSRRLEVFYAlggTRQ--------GQNKERLLPSRasVL 640
gi 564306826   562 PRSVSGCRRAPERQRRSQSEGCLKSHVEDPTLQELRRVQTDLSKRLEVFYAlgaTQQ--------GQSREQCLPPRtsLL 633
gi 1040209164  481 PNTVSGSRRAPERQRRSQSDACLKNPMEDPTLQELRRIQWDLGQRLEAFYAlgaEQQ--------GHSKGRVLPPRaaVL 552
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   655 WPNSS-KVRPSStt-sKLRASLTKNFSILPSQDKSILQKCNPQPEGEQPWPGKAEKLPSATQ------SDEDI-EAPRAP 725
gi 971386153   656 LQDEQvTSRSSS----KLKACLSKNFSILPNQDKVPLYTVDQNPAHQPDEKRDKKPLTATVPtqe-tsSGNEEnKPSGTQ 730
gi 514713743   650 LQDKQiTSRSSS----KLKACLSKNFSILPNQDKVPLYMVDQNPASQLDEKRCKKPVRDTVPaq--etSGSKDdKTSGAQ 723
gi 821459789   636 CLDSRrGPTQGSsi-sKLKASLAKNLSILPSQEKIVWQKPDSNSKCEQPSKGKAEVLSKTTSpvqeheSWERKkEVPETQ 714
gi 344280260   656 WPENNcRATPSNti-sKLKASLTKNFSILPSQDKSILQKGSPHPKGEQPWQRTAEQHANTTP------SSEKGsEVPGTE 728
gi 351712971   625 WPTSNcRVSCSSti-sKLKASLTKDFSILPNQDKNIGQRCHPHPEGEQLRQENTEKLPSTIP------SGEDG-EASRAK 696
gi 532073469   641 WPNSNcRVSPSNstisKLKASLTKNFSILPSQDKSILQKCGPLSEGEQPWQKRAELLPNAIP------PGEKD-ETPRAK 713
gi 344242222   641 WPPSNcRVSPSSai-sKFKASLTQNFSILPNQDKSILQRGSPLSECDKPCQEKAEKLPNAIF------CGEKNsGGPGDT 713
gi 564306826   634 WPPTNcRVSPSSai-sKFKASLTQNFSILPNQDKSIFQRGSPCFDSDQPCQGKAEKLPSAIF------CGKKNsRAPGDN 706
gi 1040209164  553 RPGDScRVSPSTts-sKLKASLTKNFSILPSQDKSIVQRCSPHPEADQPWQRKAEKLPNATG------SSERDhEAPGPR 625
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   726 D---RGCPTRTSVKKLIEAFSPIESVRTEGDSKNSGSSPCLRRWGVPIMPPRFPIYRGLAPLYPKPQISPALGREPPRVG 802
gi 971386153   731 MlssSSCAPRQSVKKLIETFSPTDELGKATPLRSLGPVKCIRKFGLPVIPPTIPFQRGLAPLNVKHRILPVEGTNLSNNS 810
gi 514713743   724 TlsgSSCAPRQSVKKLIETFSPTDDLEKATPLRPLGPIKCIRKFGLPVIPPTIPFQRGLVPLNIKHRISPVEDTSLSNTN 803
gi 821459789   715 GwngEGCSPQPSVKKLIETFSPAEEMVNP---RPSGEVNGIKKFGFPITPPRFPIYRGLAPLYPKHQLFPGTAGESPKLG 791
gi 344280260   729 DhhiRGHPTRTSVKKLIETFSPTDHLRTLGDSKDSEPSPCLRKWGVPIMQPRFPIYRGLAPLCPKLHISPAAGRDALNVG 808
gi 351712971   697 DcivGGCPTRTSVKKLIETFSPAESMRTPGDSKNSGSSPCLRRWGIPPMPPRFPIFRGLAPLYPKPQISPVAG-SYLNAD 775
gi 532073469   714 DcsvRGSPTRTSVKKLIETFSPTESVKTLGDSRNSGSSPCLRKWGVPIMPPRLPIYRGLAPMYTKPQISPTGSRECLKVD 793
gi 344242222   714 DwdvRGCPTRTSVKKLIETFSPNESLRMPRDSRNLGSSPCLRKWGIPAMPPRFPIYRGLAPLYPKPQISPAAGREPLKVG 793
gi 564306826   707 ErdiRACPTRTSVKKLIETFSPTESPRMPRDCRNLGTSPCLRKWGVPAMPPRFPIYRGLAPLYPKPQISPAVGRDPLKLG 786
gi 1040209164  626 DwnaRGCASRTSVKKLIETFSATESLRPPGDSKSPGSSPFLRKWGVPIMPPRFPIYRGLAPLYPKPQISPAAGRDSLGVG 705
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   803 TGWRPIAPIFPPMLTAEAPRStdISYKMEGDQEHLPPPPLEVMMDKSFTSLESPESSKSAESSPEGTPVPGLGGAGTArR 882
gi 971386153   811 GVCSNFSNAFPPIQAAELSKD--TKEETDEDIENLPPPPPEMLMDSNFDSSETEETSRIEGSLSEDAKKPAKTEFQAT-K 887
gi 514713743   804 GACSNFSNAFPPIPAAELSKD--TKEEPEVDTENLPPPPPEMLMDTSFEFSEPEETARIGENSLEDAKKPAKTESHAT-K 880
gi 821459789   792 SSWRPFAPIFTPLPTVAQVSRnaPNGETEEDLEDFPPPPPEILMDNSFNSLLNPGDPEPGGGSPAEVP----SKLPPP-R 866
gi 344280260   809 TGWRPFTPIFPPAFTAEASRSkdVNGETDEDPEHLPPPPLEILMDKSFTSLELPESSAPAGSSPKGTGMPGLEGVGPP-R 887
gi 351712971   776 MGWRPLAPVILPLPAAEASESedTHFGTEGDSEHLPPPPLEILMDKSFTSLEPPESSNPAGSSPEGTPVPGLGGSGST-R 854
gi 532073469   794 TGWRPVAPIFPPLPTAETFKNedIRCEVEGDPEHLPPPPLEVLMDNSFTSLENPESRKSTGSSPEGSPVPGLGRAGPT-R 872
gi 344242222   794 MGWRPSAP-FPSLPPAEACKRedINCEALEDLENLPPPPLEILMDKSFTALELPASSQPACSSVEEKLVPGLQENSPP-R 871
gi 564306826   787 MSWRPSAP-FPSLPPAEASEGedIGGEMEEDLQNLPPPPLEILMDKSFTALEHPEC------SLEETLLPELQEARRP-K 858
gi 1040209164  706 MAWRPLAPALPPLPPAEEPNSedVSWEGEGDPEPLPPPPLEILMDTSFASLEPPGSAVPAGSSPTEPRGTGLGRACPP-G 784
                          970       980       990      1000      1010      1020      1030      1040
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   883 RTWASPKLRASMSPVDLLPSKGTASPPRSRSTGPAISKSS--PRKP-ALDLShpPATSQNPEAEGS-AqgqGQAEKAPSL 958
gi 971386153   888 RAQVSPKMRASLQSIDLLPSKNINGPNVAANKVLRNSEQRddKLQIySLELN--PTNVHIPSQEEIlA---TQRKEAADL 962
gi 514713743   881 RAQVSPKMKASLQSIDLLPSKSI-SPSAVANKVPRSSGPKdeKLQIySLELN--PTNTHIPSQEEIlA---TQRKEAADL 954
gi 821459789   867 KTSASQRLKASLNPIDLLPSKNIPNPIPPSGKGSGDTKAErrGRNL-YLELIhvPRTGHSQERSAV-AprrPEVEEATSL 944
gi 344280260   888 RTWASPKLRASMSPIDLLPSKGTASPTRPRSTGPGSIKSGcnPRKF-ALDLNhpLATSQSPETEDR-AesqAQAEKATSL 965
gi 351712971   855 GTWVSSKLRASVSPIDLLPSKCTASPTKLCSTGLGSTKRGsnPRML-ALDPSlpPAASPDSEQEGR-AqsqAQAAKATGP 932
gi 532073469   873 RTWASPKLRASMSPIDLLPSKSTASPTRLCSTGPGSSKNGsnPRKP-VQDPNlpSAASPNPEAEGG-AhsqAQAEKATSF 950
gi 344242222   872 KTWASPKLRASMRPLDLLPSKGTGSSLRLHGTGPGIIRNVgnSRKL-TLDLNsqQAVNLSPEAEGG-AhihAQAENAASP 949
gi 564306826   859 RTWASPKLKASMSPMDLLPSKGNGSSPRLQGTRPGSTSNVgnSRKL-TLDLNsqQTANPSPEAEGG-AqiqAPPENTAGL 936
gi 1040209164  785 GTCTSPKLRASMGPRDVLPSKSTVSPSRPRSTGPAGSKVScsPRRP-ALDLHhpPAPKPNPEGASG-AqshAQAEKAASL 862
                         1050      1060      1070      1080      1090      1100      1110      1120
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926   959 NQQPRRAVPWHHSSHTS----WQNRTSD---LSLARPTQGPRSPEAPRQSrERSSPTARKASPTKAHW-VPPADKTPPSL 1030
gi 971386153   963 YKQTHKIIPLQNPSGVSkphsNSSEGMEansPPTSVPYQKHGSPDSLRRN-EKGSAFSRRVSPARTPPsSPPTEKRLFSP 1041
gi 514713743   955 YKQTHKIIPLQNPSGVSkphdNSSESKEpspPATSVPYQKHGSPDSLRRN-EKGSSFNRRVSPARTPPsspptekqlfsp 1033
gi 821459789   945 SKQPHKVIPLPQLGSTA----GLKGNKE---GSTGRPSQ----PEGPRQGqEKGPSLVRKVSPTRLHW-SHRTERRNLSP 1012
gi 344280260   966 GKHPWKAITWHHSRHTS----GQNGTLE---PSQARPTRGPHSPEASRQSqERSPLVLKKASPPRVHW-APRAEKRHPSL 1037
gi 351712971   933 SKQPRKAVAWHHTSLPS----GQSRTSE---PSLARSTRGTHSTQASRLSrERSPPVIRKTSPTKAHW-VPQADKRQHSP 1004
gi 532073469   951 SKHHRKAVPWHHASPTS----GQSRTSE---PSLARLTRGPHSPEASRQSrERSPPVVRKSSPTRAHW-APQVDRKQRGL 1022
gi 344242222   950 SEHHQKALPWHHTNATS----GQSRTLE---PSLVRPSRGPHSPEASRKGpERSPPGVRKASPTRAQW-ASQGDRRLQSL 1021
gi 564306826   937 SKHHQKAIPRHHANPTS----GQSRALE---PSLARFSRDPHSPEASRKGpERSPPGVRKASPPRAQW-ASQGGRRLQSL 1008
gi 1040209164  863 AKHPQKASAWHRSSPTS----GQNRTSE---PSLARPPRGPRSAEAPRPGrERSPAVVRKTSPPRAHW-APQADKKHRSL 934
                         1130      1140      1150      1160      1170      1180      1190      1200
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926  1031 PSSHRP-------AQPSSPTVQGSPSPPLspgvpSPPMsprvl--spptG----KKRASP-------QRQHKAS--SP-- 1086
gi 971386153  1042 PTHHRHslqafsnARPSSPTMQRKPSPPAsprapSPPS-----------Q----KKLPSP-------PAQRKLL--SPpa 1097
gi 514713743  1034 pvhhrralqafnsQQLSSPTMQRKPSPPTsprapSPPRgps-----pplQ----KKLPSP-------PAQRKLL--SPpa 1095
gi 821459789  1013 PASHRPtg---lpTQPTLPQVQRQASPPFsp-ktSPPArartp--spptSpptlRKSTSP-------LPHPKHP--SSpv 1077
gi 344280260  1038 PSSYRP-------AQPILPPVHRSPSPPFstgapSPPVsprvl--spptP----KKRTSP-------LPQHKQP--SPpl 1095
gi 351712971  1005 PSSQGP-------AQPSLPTAVSSPSPPLspgaaSPPEdnspapagcptS----AAQFQPhwsllgiPAQPKQPplSSwf 1073
gi 532073469  1023 PSSPGP-------AQPS--TVLSSSSPPLspaapSPTAslgil--sppnT----KKRTSS-------PPQHKLP--SPpl 1078
gi 344242222  1022 PSSRGL-------SQSGLPAVLSSPSPPLsprtl-----------sppaA----RTPTSP-------PCGHMQP--NPaq 1070
gi 564306826  1009 PSTHGP-------SQPGLRAVLSSPSPPLsprtl-----------sppaT----RKPTSP-------PCQYPQS--NPap 1057
gi 1040209164  935 PASHRP-------AQ-SPPAAHSSPSPPLspaapSPPVsprvl--spppT----KRRTSP-------LPPHKLP--SPpp 991
                         1210      1220      1230      1240      1250      1260      1270      1280
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926  1087 ---------------PTQCPEASSPSSLP--------------------SPSSPVSLSQGHKETRDSEDS----RADTAq 1127
gi 971386153  1098 ehkqssssphrppgsPAYRRDTGPAPFPI--------------------APSPPTSPSRSYRGSRAGLDAgdepQPSSSk 1157
gi 514713743  1096 ehkqssptphrlpgsPVYRREASPTPFLT--------------------ASSPPTSPSRSYKGSKTGLDAgdeyQPASSk 1155
gi 821459789  1078 evpqsppapqelsspLVSHREVSPPSSGS--------------------TSTPPTSPSQEPKEQSSWGDR----DPAPAk 1133
gi 344280260  1096 v------------spPTQSREASSPSSGP--------------------SPSTPVSPSQECKEARDSEDC----PSAMVk 1139
gi 351712971  1074 rlpcgqqfqeevkpqPQGDTEENQPPGLSfrfmrnlggeqqdlghgkeqDSACPLVPTR---------------PNHSRw 1138
gi 532073469  1079 gsppa----qpkvssPAQHTEASPPSSVP--------------------SPSPPGSPSQGCKETRDSEGN----QAPAAk 1130
gi 344242222  1071 g------------scPVQQTETNTPSSAS--------------------SSSPSVSPSQWSKENSHSEDG----EATTAk 1114
gi 564306826  1058 g------------spPVQRTETNTPSSAS--------------------SSSPSVSPSRGSKDSSHSEDS----EGTTNk 1101
gi 1040209164  992 a------------spPTQHPEANSPSSAP--------------------SPSPPGSPSQGHKERGDSEGS----QAATAe 1035
                         1290      1300      1310      1320      1330      1340      1350      1360
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926  1128 vSGNTCSIFCPAASSLFETRLPLSTAQSl----tPPEAGGPLRSPAGGWRSSSGPRLRADSQRRGALCALNPLPFVRRTA 1203
gi 971386153  1158 kGSNVHSIFCPATSSLFEARPPPAPSKP------SEELTGQPEASKPSQKSSLLFLQVGAQTRKLSLSAANPQPFVRRSF 1231
gi 514713743  1156 kGSNVGSIFCPATSSLFEARPPPAPSKP------TVEVTKQTEASPPSQKSSLLLQQPADRTRKLSLSAANPQPFVRRSF 1229
gi 821459789  1134 vAPNTCSIFYPASPSLFEAKSPSSPKAS------HPESGEHPEMAAEAKRTAVSPRPWGEPQRRMALCALNPQPFIRRTA 1207
gi 344280260  1140 vSGNTCSIFYPATSSLFEAKVPLSRPHPltspslPPEAGGSLGMPTGCWRSSSGPRRRVESQRRVALCALNPQPFIRRTA 1219
gi 351712971  1139 aGGHTARTAQPDKPDM-ERQRPGAKGEPlg---fVRELG----------RNTQKPEEWGGSQEEE---QHT------RVR 1195
gi 532073469  1131 aSRNTCSIFCPATSSLFEAKSPSLTAHLqtstslPPEPGGALGTPAGCWRSSLEPRLKADSQRRMALCALNPLPFVKRTA 1210
gi 344242222  1115 aPRNTCSIFCPAASSPFEAKSSFSIPHPr----tLPEHGGPLRNPTGGWRGNSGPRLRADSQRRTALCALNPLPFVRRTA 1190
gi 564306826  1102 aSRGTCSVLFPATA-FCEAKSSFSTSHPq----tLPEPGGLLRTPAGGWRGSAGPRLRADSQKRTVLNALDALPFVRRTA 1176
gi 1040209164 1036 aPGNARSIFCPATSSLFEARSPLSTAHLlappslPPGCSG--------------------SQRRMALCALNPQPFIRRPA 1095
                         1370      1380      1390      1400      1410      1420      1430      1440
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395828926  1204 SD--RRPGARLPLPASglTGTSCDSQLSq-SS-----------SSEESLgKDTEPWSNPSAPELQGS-SRHAPPPELCVL 1268
gi 971386153  1232 SD--RRPGVRFFLPAP--VSAASEPALN--QSrcittehlsfcSMDESPrKAGDPWSNPCAPEIKES-NRSASHPELYVV 1304
gi 514713743  1230 SD--RRPGVRFYLPa---PVTAGSEPALn-QA-----------SAEESPgKAGDCWSNPCAPEIKES-NRSTSHPELYIV 1291
gi 821459789  1208 SD--HRPRVRLRLPGSasVGTTSELCS---QI-----------SSEESSpKEAAAWNSLCSPDTKGS-SKWASQPELYVV 1270
gi 344280260  1220 SD--HRQGTRLQLPVSgcTGTASESQLSh-RS-----------SSEESPrKGNEAWSSSYSPELK---QRRVSPPELCIL 1282
gi 351712971  1196 SDlvLSPRS---------------------SS-----------SSEDSPkQDVAPWSSPHVPELQGGgGSWASPPELYVL 1243
gi 532073469  1211 PA--CHPGVRIQLPGSssTGSSWEPQLDqsSS-----------SSEDSPkLNASTWSSPCAPEPQGGsSRCASPPELCVL 1277
gi 344242222  1191 SDrqRQQGDPLLLPSSswDSHPCQSS----SS-----------SSEESPkQESPSWNNSRAPEFQGSgTKWASPLELCVL 1255
gi 564306826  1177 SDrqRQQGDPLQLPSSdwESHPCQNSS---SS-----------SSEENAkQELPPWNNSRVPELQSSsTKWTSPLELCVL 1242
gi 1040209164 1096 AH--RQPGLQLQLPGSspTGTPWDSQLSq-SS-----------SGEESPkQDAEPWGGPCGPELQGGgSRRASPPELCVL 1161

                   ....*
gi 395828926  1269 GHGMQ 1273
gi 971386153  1305 GQGLQ 1309
gi 514713743  1292 GQGLQ 1296
gi 821459789  1271 GRGLQ 1275
gi 344280260  1283 GHGLQ 1287
gi 351712971  1244 GHRLQ 1248
gi 532073469  1278 GHGLQ 1282
gi 344242222  1256 GHGLQ 1260
gi 564306826  1243 GHGLQ 1247
gi 1040209164 1162 GHGLQ 1166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap