Conserved Protein Domain Family
CCDC154

?
pfam15450: CCDC154 
Coiled-coil domain-containing protein 154
CCDC154 is an osteopetrosis-related protein that suppresses cell proliferation by inducing G2/M arrest.
Statistics
?
PSSM-Id: 317803
View PSSM: pfam15450
Aligned: 12 rows
Threshold Bit Score: 498.589
Threshold Setting Gi: 308464459
Created: 28-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187661954  48 ASGSLVPEQDTSKLWKQLEQWVAELQAEVVRLRGHKERCEHATLGLLRELLQVRARVQMQASELRQLRQVV-QQAAWSPE 126
gi 831227344  82 VSTTSVPEQDTAKRWDQLEQWVASLQAEMARLQGHEERCEHTMLSLLRELVRLRAHVQLQGSELTQLQREVqQQAARTPE 161
gi 884940754  55 VSSSPPPEQDISKH---LNECVAKLQAEVVSLRGHKVHCEQASLSLQRELLQVHGHMQQQSSELQQLWQEI-KRVAHVPE 130
gi 914924451  84 ASNACVPEPSTSKRWEKLEQWVGDLQAEVACLRGHKERCEHATLSLLRELLQMRAHMQLQASELRQLRQEM-QQVAQAPE 162
gi 215277041  55 TSTASVPEQDTAKHWNQLEQWVVELQAEVACLREHKQRCERATRSLLRELLQVRARVQLQGSELRQLQQEA-RPAAQAPE 133
gi 821469429  39 GSSKFTIEQDSPKRWKQLEQWVADLQAEVVCLRGQKERSDQAVLSLLRELLQIRARIQVQDSELELIRDEV-KQLTRIPE 117
gi 927109071  91 TSTASVPEQLAPEHPQQLEQWVVDLQAEVASLWGHKAHCERATLRLLQELLQVRARLQLQDAELERLRHEV-RQAAQAPE 169
gi 982966344  88 QSEASDLEQGTLKRWKQLEQWVADLQAEVASLRGHRARCEHATLSLLRELLQVRACLQLQDTQLKRLQLET-RRVAPAPE 166
gi 587017612 127 ASATSVPEQDPPKPWKQLEQRVADLQAEVVSLREHRDRCEPAMLSLLREMLRLRACVQLQDSELKKLQQDL-RRVAQAPE 205
gi 928138163   7 hlpppcPERDSPGHWRQLEQWVADLQAEVASLRGHKDRCERAMLSLLREMLQLRACGQLQDAELKRLQQDV-RQAVQAPD 85
gi 558179777 111 ASTTSVPEQDTPKRWKQLEQWVADLQAEVVSLRGHKDYCERATLSLLQELRQVQASVQLQDSELKKLKQEL-QQAAWVPE 189
gi 308464459  76 ARKRLEQNQDALTRRLQNNESSGVQSRDFDDVRRQMNGMDAKLMIMNNDIAGLRTSMDRQVTDLMHINSEMkSRPVVDPS 155
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187661954 127 KEELELSGPQS--QNQMQTLDKRLVEVREALTHIRRKQALQDSERKHSEQEINLRLTNLTGMLSQEEQGREAACSALQKN 204
gi 831227344 162 KEAPEFLGPQNqnQNQMQALDQRLVEVREALAQIRRKQTLQDSERKGAEQEAALRLATLTDLVKQEEQGREAACSTLQKS 241
gi 884940754 131 KEVQVFSGAQN--QNQIQILDKRLVEVRESLTQIRRRQALQDAERKGSGQEANLRLTKLSGWLRQEEQAREAAYSSLQKS 208
gi 914924451 163 KEALEFPGPQN--QNQMQALDKRLVEVREALSQVRRRQALQDVQRKGAQQEANLRLTKLTGLLKQEEQGREAACSALHKS 240
gi 215277041 134 KEAPEFSGL----QNQMQALDKRLVEVREALTRLRRRQVQQEAERRGAEQEAGLRLAKLTDLLQQEEQGREVACGALQKN 209
gi 821469429 118 KEACEPSSATG--RSHMELMEKRLVEVREALTQVRRKQALQETEKKNFETELTLRLDKLNGDLKEEAEGRETACSTLLQN 195
gi 927109071 170 KEALQFPSLQH--QNQMQALDRRLVEVREALTHIRRKQALQDSERKAAEQEAGLRLAELTERLKQEAREWEVACRALQKS 247
gi 982966344 167 KEAVQVG--RQ--QNQMQALDKRLVEVREALTQIRRKQALQDSERKGAEQEASLRLSELTGKLKQEEQDREMACGALQKS 242
gi 587017612 206 KEALEFPSPQN--QTQMQALDRRLVEVREALTQVRRKQALQDSERKDTEQEASLRLAELAGRLEQEEQSREAACRGLQKS 283
gi 928138163  86 KEVLECPGAQN--QNHMQTLDKRLVEVREALTQIRRKQVLQDSERKDAEQEASLRWAELAGKLEQEEQLREAACSALQKS 163
gi 558179777 190 KEALEFPSPQN--QNKMQALDKRLVEVREALTQIRKQQALQDSERKGTKQEANLRLTKLARKLEQEEQNREVACSALQRS 267
gi 308464459 156 KI-----------SNATSQLDSKLRDMHNQVMDLQKNLSREQRDREKDSKTAGDGIQRLQDMIRQQDLARQDIMANLSKK 224
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187661954 205 QEDTSQKVDLGLAKMQAQMTKLNEEMSLRFLKREAKLCSFLQKSFLALEQRMKSSESTRQIAESSLREELESRWQKLHEL 284
gi 831227344 242 QEDASQKLGHEVARMQAQVTKLSEEMSLRFLKREAKLCSFLQKSFLALEKRMKAAESSRLRLECRLREELEGHWEALQEL 321
gi 884940754 209 QEDTSQKVDHEVAKMQAQLTKLGEEMSLRFLKREAKLCSFLQKSFLALEQRMKALEGTRLETERSLREELEGHWQKLQEL 288
gi 914924451 241 QEDASQRVDHEVAKMQAQVTKLGEEVSLRFLKREAKLCSFLQKSFLALEQRMKASESTRLQAEGSLREELEGRWQRLQEL 320
gi 215277041 210 QEDSSRRVDLEVARMQAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGSLRGELESRWEKLRGL 289
gi 821469429 196 QEESACRTSRDIAGIQAQALQLGEEMSLKFLKREAKLCGHLQKNFMAIEKKMKVSENTRLKSEKNLWEELEVKWQKIQVL 275
gi 927109071 248 QEAAGQRVDVEVARMQAQMTKLGEEMSLRFLKREAKLCGFLQKSFLALEKRMKASDSARLRAESSLRQELESRWQQLHER 327
gi 982966344 243 QEEAGQKVDHEVARMQAQMTKLGEEMSLRFLKREARLCGFLQKSFLALEKRMKASESARLRAESALREELEGRWRQLQEL 322
gi 587017612 284 QEEASQRADLEVAKTQAQVTKLGEEMSLRFLKREAKLCGFLQKSFLALEKRMKVSESARLKAEGSLREELDSRWRGLQEL 363
gi 928138163 164 QDEASRRVDREVARMQAQVTKLGEEMSLRFLKREAKLCSFLQKSFLALEKRMKASESTRLKAESSLRGELDSRCQRLQDL 243
gi 558179777 268 QEEASQKVDQEVARLQAQVTKLGEEMSLRFLKREAKLCGFLQKSFLALEKRMKTSESTRLKVESSLREELESRWRNLQEL 347
gi 308464459 225 GDVDKEKLNEETRRLNDKINLITAEVTRKMTENQQKTKDDLTSRIAVLENMIRAQSERIVTNENEMRHSYEAK------- 297
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187661954 285 TEERLRALRAQRevglggqQEEEGHLLEQCRGLDKAVVYLTKFVRQNQVSLNRVLMAEQKARE-------AKVSLEETQA 357
gi 831227344 322 TEERLRSVCGQR-------QQEQGHLLAQCRSLDAAVVQLTKFVRQNQASLKRILMTEQKARD-------AKGCLEESQA 387
gi 884940754 289 TEERVQALWGQHe------QEEEGCLREQCRGLDAAVVRLTKFVRQNQMSLSHILLMEQKARV-------SKVGLEESQA 355
gi 914924451 321 TEERMQALGAQR-------QEEEGHLLEQCRGLDAAVVQLTKFVRQNQVSVNRILLAEQKARD-------TKVCLEESQA 386
gi 215277041 290 MEERLRALQGQHevgpggrRAEESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKAWD-------AKGRLEESRA 362
gi 821469429 276 NEDHFRSLKHQQe-------QEESRLLDQCRALDNAVIQLTEFVRENQTSLNRVLQAEQKNRE-------AQEQYEKESV 341
gi 927109071 328 DEERMQALRGHC-------QQEECHLLEQCRGLDKAVVQLTEFVQQNQASLNRVLLAEQKAWA-------AKGHLENSRA 393
gi 982966344 323 DTERVRALQGQCq--------EECHLLEQCRGLDKAVVQLTEFVQQNQVSLNRVLLAEQKAWD-------AKGQLEDSRA 387
gi 587017612 364 AEERVRALQGQHe------QQEARRLLEQCRGLDRAVVQLTKFVRQNQVSLSRILLAEQKARD-------VKGHLEESRA 430
gi 928138163 244 AEERAQALQGQQe-------QEECRLLEQCRDLDQAVIQLTNFVHQNQVSLNRILLAKQEAWD-------SKGQAEESRA 309
gi 558179777 348 AEERLQALRGQCk-------QEESYLLEQCRGLDRAVVQLTKFVRQNQVSLNRVLLAEQKAQD-------TKGHLEESQA 413
gi 308464459 298 ----LADLTGQLevamkqiTSEKAKQKERFQKVNEALAALEHHLELGNNKIDKLMNSEIQARKlhekgllAKMTDIEERV 373
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187661954 358 GELASYVHENLEAVQ----------MAGKLAQQETQD-----------ALELLQEK----SQVLEGSVAGLDQQLKDLSD 412
gi 831227344 388 EELASQVQESLEAAQ----------LANDLAWQETHR-----------QLAVLQEK----SQGLEASVAQLAGQLKDLND 442
gi 884940754 356 EELASYMQENLEAVQ----------LESKLAQKETQD-----------AVELLQEK----SQVLEKSVAKLAQQLKDLDD 410
gi 914924451 387 GELASFVQENLEAVQ----------LAGELTRQEMQG-----------ALELLQEK----SQVLEGSVAQLARQLKDLSD 441
gi 215277041 363 GELAAYVQENLEAAQ----------LAGELARQEMHG-----------ELVLLREK----SRALEASVAQLAGQLKELSG 417
gi 821469429 342 EKFTMKLQNDISAVR----------ESFDNAHREARS-----------ELEKIQEK----SQVLEESIGRLVREVRDLSD 396
gi 927109071 394 GELAAYLQENLAATQ----------MAGELAQREIRS-----------ALELLQEK----SQALEVSVTELVRQVKDMSD 448
gi 982966344 388 GELATYLQENLEAMQ----------LAGELAQQETQG-----------ALELLREK----SQALEVSVAELVRQVKDLSD 442
gi 587017612 431 GELATCLREDLKAVQ----------LAGELAQREVHS-----------ALDLQREK----SQALEVSLAELETQVKDLSD 485
gi 928138163 310 GELAAYVQESLAAMQ----------LAGELTQREAHG-----------ALQLLREK----SQALEESLAELGKQVKDLSD 364
gi 558179777 414 GELAAYLQENMEAMQ----------LASEQARQETQS-----------TLELLQEK----RQALEGSVAELVTQVGDLND 468
gi 308464459 374 NNYVGGMNKSIDEMKngknnvqmpaLDTDALRREMEAiaadknklsmeGLLKLEEKmsrvQQGFYHDRKEINTRLTDLGD 453
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187661954 413 --HCLALSWRLDLQEQTLGLKLSQKQAAWEGMERESLKDLVQWLKEVTAHLEEVQEKVNSLPQQIESISNKCVIHKSEVD 490
gi 831227344 443 --QFLTLSWRLDLQEQMLGLRLSEVRNEWEGAERRSVEDLARWQKEVAAHLRGMWEKVDSLPRQIESISDRCIFHKSDSD 520
gi 884940754 411 --HCLALSWRLDLQEQTLGLRLSETKTQWEGVERKSLEDLAQRQKEVAAHLQEVQEKVDRLPQQIEGVSDKCILHKSDAD 488
gi 914924451 442 --HCLAVSWRLDLQEQTLGLKLSEVKTEWEGVERKSLEDLARWQKTVSTHLREVQEKVDGLPRQIEGVSDKCIFHKSDTD 519
gi 215277041 418 --HLPALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLEDLARWRKEVTEHLRGVREKVDGLPQQIESVSDKCLLHKSDSD 495
gi 821469429 397 --HFVALSWKFDLQEQTLNLKMSEARKECSEEEKKALEKFIQWQNETIVHLKELQEKVESFLKQIGDVNDRCLLHRNDSD 474
gi 927109071 449 --HFLALSWRLDLQEQTLSLKLQEAHSEWEAAEQRSRADLAQWREEAEAHLQEVQEKVDSLPRQIEAVSDKCVLHKSDSD 526
gi 982966344 443 --HFLALSWRLDLQEQTLSMRLRETQSEWEVAEQRWREGLTRCREEAEAHLREVQERVDQLPQQIEAVTDKCVLHKSDSD 520
gi 587017612 486 --HFLALSWRLDLQEQTLSLRLSEAKREWEGSEQKSLEGLVRCQKEAEAHLREVRERVDSLPRQIEAVSDKCVLHKSDSD 563
gi 928138163 365 --HFVALSWRLDLQEQMLRLRLSEAKREWEGLEQKSLEGLVQCRKEVEAHLREVWERVDSLPRQIEAVSDKCVLRKSDSD 442
gi 558179777 469 --HFLALSWRLDLQEQTLTQKLCEAKSEREGAERRSMEGLAWCRKEAQAYLREVRETVDSLPRQIEAVSDRCVLHKSDSD 546
gi 308464459 454 geHVNKI--RAQLN------KMDALQEDMEKAQDRIRDKV---ERQIPQDLNELSAKADNIKHQL--------------N 508
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 187661954 491 VKISAEGKAREFEVETVRQELAAL-----------LMSVQLLKEENPGRKIAEIQGQLAT--KQMIKLENSLQANKTIQN 557
gi 831227344 521 LKICAEGRARESEVGALRQELTAL-----------LSSVQLLREESPGRKIAEIQGRLATfqNQIIKLENSIQANKTIQN 589
gi 884940754 489 LKILAEGKAREFEVKVMRQELATL-----------LSSVQLLKEDSPGRKIAEIQGKLATfqKQMIKLETSIQANKTIQN 557
gi 914924451 520 LKISAEGRVREFEVGAMRQELATL-----------LSSMQLLKEESPGRKIAEIQGQLATfqKQMIKLESSMQAHKTIQN 588
gi 215277041 496 LRISAEGKAREFKVGALRQELATL-----------LSSVQLLKEDNPGRKIAEMQGKLAT--NQIMKLENCVQANKTIQN 562
gi 821469429 475 QKIITESRTRKHEMGIVRQELAVV-----------LSALQLLKEDNPNRKIAEIQGKLTTfqSQIMKMENNIQDNKTIQN 543
gi 927109071 527 LKISAEAKAREFEVEAVRQELAGL-----------LSSVQLLRGGNPGRKIAEIQGKLATfqNQMMKLENSIQDNKTIQN 595
gi 982966344 521 CKISAEATARELAVEAVRQELAAL-----------LSSVQLLREGNPGRKIAEIQGKLATfqNQMMKLETSIQDNKTIQN 589
gi 587017612 564 LKISAEGKAREFEVGAVRQELASL-----------LSSVQLLREGNPGRKIAEIQGKLVTfqNQIMKLENSIQDNKTIQN 632
gi 928138163 443 LRISAEGKAREFDFEAMRQELAAV-----------LSSVQLLKEGNPGRKIAEIQGQLATfqNQIMKLETSIQDNRTIQN 511
gi 558179777 547 LKISAEGKAREFEVEAMRQELAAL-----------LSSVQLLREGNPWRKIAEIQGKLATfqNQIIKLENSIQDNKTIQN 615
gi 308464459 509 TRIDNEEEERYLAIKELQEAFTTLqqtqysggktaASSDQQMKRDVDECKIA------------IKKLAESVTTVKNVLD 576
                        570       580
                 ....*....|....*....|.
gi 187661954 558 LKFNNETKLRTEEIATLRESM 578
gi 831227344 590 LKFNTETKLRTQEMAALRESM 610
gi 884940754 558 LKFNTETKLRSEEIAALRESM 578
gi 914924451 589 LKFNTETKLRTEEIATLRESV 609
gi 215277041 563 LRFNTEARLRTQEMATLWESV 583
gi 821469429 544 LKFNTETKLRVEEIAHLRENV 564
gi 927109071 596 LKFNTETKLRTEEVAALRESM 616
gi 982966344 590 LKFNTETKLRTEAMATLQESV 610
gi 587017612 633 LKFNTETKLRAEELASLRESV 653
gi 928138163 512 LKFNTETRLCMEEMASLRESV 532
gi 558179777 616 LKFNSQIKMRMEEMATLKECL 636
gi 308464459 577 KKITDETKRREDDVSSLRRQM 597
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap