Conserved Protein Domain Family
Pilt

?
pfam15453: Pilt 
Protein incorporated later into Tight Junctions
Pilt is a family of eukaryotic tight junction-proteins that binds to guanylate-kinase. Pilt is a component of TJs (Tight junctions) rather than AJs (Adhesin junctions). The protein is incorporated into TJs after TJ strands are formed, thereby suggesting the name Pilt for 'protein incorporated later into TJs'. Pilt binds to the guanylate-kinase region of hDlg otherwise known as Disk large homolog.
Statistics
?
PSSM-Id: 317806
View PSSM: pfam15453
Aligned: 8 rows
Threshold Bit Score: 407.785
Threshold Setting Gi: 47222368
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597767163 310 QSSSAASDQQhvNGMCRGQASPDGPSAEd-mAPSFEKLNPYPAPPPPHPLYPGRKVIEFsSDDKVKIPKNSPLPNCTYAT 388
gi 556999252 284 QVPAEGGKQH--NGLCGRQNVTESPPDE---GLAFETLNPYPTPTPPHPMYPGRKVIEF-SDDKVKIPKNSPLPNCTYAT 357
gi 47222368  456 ESHLDGERLQ--NGSLCSHSSLEEDVGG---ASAFEKLNPYPPPPPPNPLYPGRKVIEFsSDDKVKIPKNSPLPNCTYAT 530
gi 768916025 281 EINQEAEQLQ--NGSLCSHSSLEEEVGG---VSAFEKLNPYPPPPPPNPLYPGRKVIEFsSDDKVKIPKNSPLPNCTYAT 355
gi 528497141 302 PPAVADTDQQhvNGMCRSQGSLDGPTGDdgaAPSFEKLNPYPTPSPPNPLYPGRKVIEFsSDDKVKIPKNSPLPNCTYAT 381
gi 524991037 283 KEGGDAGKQQ--NGGCKPQSSVESVPEE---VPAFEKLSPYPTPSPPHPMYPGRKVIEF-SEDKVRIPKNSPLPNCTYAT 356
gi 565319359 606 SKGKEGSRQQ--NGSCKSQNCLESLPKE---VPTFEKLSPYPTPPPPHPMYPGRKVIEF-SEDKVRIPKNSPLPNCTYAT 679
gi 637256787 283 NEVSGGTRQQ--NGNCKSQACLES---D---VPTFEKLSPYPTPPPPHPMYPGRKVIEF-SEDKVRIPKNSPLPNCTYAT 353
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597767163 389 RQAISLSLVQNDEEAG-ERQRTVPNSPAVSDGGW-----------RSGTSsssggghasLPRTPQqt-dV-TDPLSS--- 451
gi 556999252 358 RQAISLSLVQGEEDGGqDRHRTVPNSPVSEGRRSlqapsgrpysrGSSTK---------LDASRG----SeNEPRSL--- 421
gi 47222368  531 RQAISLSLVQNDDE------RHVPGSPAPSF----------------------------HQRTPP----------SQcda 566
gi 768916025 356 RQAISLSLVQNDDE------RHVPGSPAPSS----------------------------HKRTPPpqgdAaSEPLSS--- 398
gi 528497141 382 RQAISLSLVQNEEEAA-ERQRTVPNSPAISDGGW-----------RSGTSsssgggiasHQRTPPqm-dA-TDTLSS--- 444
gi 524991037 357 RQAISLSLVQSEDESC-DRHRTLPSSPASEGRRS-----------ASSCS---------CQQSPK----AaRAHGSS--- 408
gi 565319359 680 RQAISLSLVQGEDENC-DRQRPLPSSPAS-GQRS-----------ASSCS---------YQPSPK----LsRVPGSS--- 730
gi 637256787 354 RQAISLSLVQGEDESC-ERQRTLPSSPASEGQRS-----------ASSCS---------YQPSPK----AnRAPGSS--- 405
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597767163 452 -------QSSPFSSPPQPPSAFASSGSSEEDLLANWQRMFVEKMAPSSEGTLINRTSFSNETVKELHRSRnsksGRGAAD 524
gi 556999252 422 -------QSSPFSSPPQVPSTFASSASSEEDLLSNWQRMFVEKVAPSSETSFIHRTSFSHDTAQDLQKTL----SRSMQE 490
gi 47222368  567 aseplssQSSPFSSPPQAPSVLASSGSSEEDLLANWQRMFVEKMAPSCERSVVHRTSFSSQTAQELQRRRlapgGGATAA 646
gi 768916025 399 -------QSSPFSSPPQAPSVLASSGSSEEDLLANWQRMFVEKMAPSCDGSVVHRTSFSSRTAQELQRRRlapgGVA-PS 470
gi 528497141 445 -------HSSPFSSPPQPPSAFASSGSSEEDLLASWQRMFVEKMAPSSDGSLVNRTSFSSETVKDLQRSHngksGVGA-- 515
gi 524991037 409 -------QSSPFSSPPQIPSAFASSASSEEDLLANWQRMFVDKAPPTSERVLMNRTAFSRDTAPELQKRF----SRSMQE 477
gi 565319359 731 -------QSSPFSSPPQVPSTFASSASSEEDLLANWQRMFVDKAPPATEQVLVNRTAFSRDTAQELQKRF----SRSMQE 799
gi 637256787 406 -------QSSPFSSPPQVPSTFASSASSEEDLLANWQRMFVEKAPPTTERVLVNRTSFSRDTAQELQKRF----SRSMQE 474
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597767163 525 HGMMRGAYSDGEEGSSAQSWTASRESSLDTDTSSVAdlRSKRGH----YGGD--FSQEEGEHLLMGTDn--EDGASGDTM 596
gi 556999252 491 LGKAAPAYSDREDCARSCGWTPSRGSSLDADNVDSL--AASKSH----YVAErpPPEDTASQPLLQTC---EMGEAAAAS 561
gi 47222368  647 ADRHRAAYSDGEEGSSVRSWTPSRGSSLDTDT-DAEprPGRRGH------------EEAGERLLMSLE---DEGDR---A 707
gi 768916025 471 SDCHRAAYSDGEEGSSVRSWTPSRGSSLDTDT-DVEprPSRRGHfg--------cGEEGGERLLMNLE---DEGDREDAA 538
gi 528497141 516 ---LRGAYSDGEEGSSAQSWTASRESSLDTDTSSMAdlRAKKTQ----YGGD--FSHEEGEHLLMALDpldNDGASGDTM 586
gi 524991037 478 LGRAASAYSDGEESAQSCSWTVSRDSSVDTDSTES---RARRSHfssdYGTD--FSQDEAQKLLLES----SGGTAESES 548
gi 565319359 800 LGRVASAYSDGEESVQSCSWSVSRDSSVDIDSTEF---RSRRNHfssdYSTD--FSQDESCKLLQGSG---TEGMAEPAT 871
gi 637256787 475 LGRAASAYSDGEESVQSCSWTVSRDSSVDTDSTES---RARQSHlssdYGTD--FSQEEARKLLQEAG---SEGLADPAI 546
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597767163 597 VTVESSPasaKRQEFVEDVGSASSLTEERD----------------VLPQDfpvvgSRVLAGLEDYTDKPPsqrqhhhhq 660
gi 556999252 562 VMAKASPl--AKRKDYVDMDSPGSSAEERE----------------VLLQE-----SRSVGLTAEDAAESP--------- 609
gi 47222368  708 VPVATSP----------E--------EMRGkeeqeqeeeeeeeerdVLPHElpvipPRLL-------DFDAa-------- 754
gi 768916025 539 VALATSPdeiHVKEEEEE--------EERD----------------VLPHElplisPRLL-------DFDAt-------- 579
gi 528497141 587 VTIESSPasaKRQEFAEDVGSAGSSAEERD----------------VLPQDfpvigSRVLSSLEDYADKPPr-------- 642
gi 524991037 549 ----PSA---EKHKDYVDLGLPESPAEERE----------------MLLQGnkessQGGVQEESGEGRVKP--------- 596
gi 565319359 872 ----SSP---EKSKDYIDYPS-GSPAEEQE----------------LLLQDrrensQEGVSEQSKDAKSKP--------- 918
gi 637256787 547 ----SSP---GKHKDYVDLDSPGSPSEEQG----------------MLLQGskennQDVVLEQSTEVGKSK--------- 594
                        410       420       430
                 ....*....|....*....|....*....|....
gi 597767163 661 sGSSRPHKSPKRMGVHHLHRKDSLTRAQEHGNLL 694
gi 556999252 610 -PSSRPHRSPKRMGVHHLHRKDSLTRAQEHGNLL 642
gi 47222368  755 vALQRPQRSPKRMGVHHLHRKDSLTRAQEQGTLL 788
gi 768916025 580 lGLQRPQRSPKRMGVHHLHRKDSLTRAQEQGTLL 613
gi 528497141 643 tGSSRPLKSPKRMGVHHLHRKDSLTRAQEHGNLL 676
gi 524991037 597 -AFSRPHRSPKRMGVHHLHRKDSLTQAQEQGNLL 629
gi 565319359 919 -PPGRPHRSPKRMGVHHLHRKDSLTHAQEQGNLL 951
gi 637256787 595 -PPGRPHRSPKRMGVHHLHRKDSLTQAQEQGNLL 627
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap