Conserved Protein Domain Family
Pro-rich_19

?
pfam15455: Pro-rich_19 
Proline-rich 19
This family includes proline-rich protein 19.
Statistics
?
PSSM-Id: 317808
View PSSM: pfam15455
Aligned: 10 rows
Threshold Bit Score: 360.718
Threshold Setting Gi: 1022962249
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122133324    1 MDPGEPAPKPFQQPEKPGRVRRRKTRRERNEALA-------GSRQPLTYQH-----PPVASRDPhmv-------lrnSVA 61
gi 187611337    1 MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALV-------GSRRPLAHHD-----PPVAIRDP-------------PVV 55
gi 532105239    1 MDSRRPAPQPFQQPEKPGRVRRRKTRRERN-ALV-------GSRRG-SRQDlmapwNPVAPRD--------------PVA 57
gi 513023688   30 MDPRGPNRQSFQQPEKPGRVRRRKTRRERNEALV-------GSRRPLAHHD-----PPMSSQDPpva-------lrdPVV 90
gi 562824652    1 MDPRGPTLRPFQWPEKPGRVRRRKTRRERNEALL-------GSRRPLVGQD-----PPVSSRDLpva-------pqdPVV 61
gi 344269303    1 MDPQGPAPQPLQQPEKPRRVRRRKTRRERNEALV-------GSRRPMAHQD-----PLVASREaavthrkppvalrnPMA 68
gi 395854080    1 MDPRGPAPQPFQRPEKPGRVHRQKTRRERNKALV-------GSLRPLARQN-----PPVTSRDPpaa-------frdPVA 61
gi 1022962249   1 MEHRGLAPRPVQQADRTGRVRHRRTKRERNQARAsrgpsagGPRIPRARPR-----CSLAHRDP-------------ALG 62
gi 672035210    7 MDPRGPAPQPFQQLEKPGRIRRRKTRRERNKALV-------SSHRPLARQD-----PPISSRDPcvi-------fqePAT 67
gi 554585031   12 MDPRGPTPQSFQRAEKPGRVRRRKTRRERNEALV-------GSRRPLAHQE-----PPVASRNPpmd-------lqdHVA 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122133324   62 PTAAKLVVITQGRLSRDHRGLFNHEVKSLDVARLLSSESLELGTPALTTKSSPSPGRG--------------------QQ 121
gi 187611337   56 PTASKLVVITQGRLSREHRGLFNHEVKSLDVARLLSSGTLVPGSPTLPAKPSPSPGRA--------------------QE 115
gi 532105239   58 PSASKLVVITQGRLSREHRGLFNHEVKSLDVARLLSSGSLESGTLFLQTKPSPNPGRV--------------------QE 117
gi 513023688   91 PAASKLVVITQGRLSREHWGLFNHEVKSLNVARLLDRGSLEPRTPPLPTKPSSSPARI--------------------QE 150
gi 562824652   62 PTAPKLVVITQGRLSQKHRGLFNHEVKSLDVARLLSSESLEPGILQLPTKPSPSPGGA--------------------QV 121
gi 344269303   69 PAAPKLVVITQGRLSREHWGLFNHEVKSLNVARLLSSRVLEPDTPSLPTRPSPSLGSA--------------------QA 128
gi 395854080   62 PIAPKCVVITQGRLSREHRGLFNHEVKSLDVARLLSSGVLEPDTTPLSTKLSPSPGKV--------------------QE 121
gi 1022962249  63 PPAPKPVVITQGRLSRAHRGLLGKEVKSLNVDRLLSGLAEEVSSPPAGETPAPETAATavtaaaaaaaaatplplawgEE 142
gi 672035210   68 STAPKLVVITQGRLSREHRGLFNHEVKSLDVARLLNRGSLESCTPLLPTKSSCSPVRV--------------------QE 127
gi 554585031   73 PTAPKLVVITQGRLSREHRGLFNHEVKSLDVTRLLSSGSLEPDTPTFSTKPSPSPGRA--------------------QE 132
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122133324  122 P--SLQSRGKENQVPGGSGPGPPSPPQLPDLEQLLGELQCQLILPRAFPRRNLVQEARDAIVGTLQACHGCVPDLTLVLR 199
gi 187611337  116 P--APRSRDKENQVPGGSGPGPPSSPELSGVGQLLAELQCQLSLPQAFPRRNLIQDARDAIVHTLQACHGCVPDLALVLR 193
gi 532105239  118 P--E-QSKGKENQVPGDLGPGPPHSPELPCLGKLLGELQCQLILPQAFPRRNLVQEARDIIVGNLQACHGCVPDLSLVLR 194
gi 513023688  151 P--ASQSRGKENQVPGGSGPGPPNFPELPGLGQLLEELQCQLILPQAFPRRNLVQEARDAIVGTLHALHGCVPDLALVLQ 228
gi 562824652  122 P--ASQSRGKENQMPGGSSLGPSSSPELPDLVQLLGELQCQLLLPQAFPRRNLVQEARDTIVGTLQACHGCVPDLALVLR 199
gi 344269303  129 L--APQSRGKENQLPGGSGPGPPSAPELPGVGQLLQELQCQLILPQTFSRRNLVQEARDTIVGTLQACHGCVPDLALVLR 206
gi 395854080  122 P--ALQSRGKENQIPGGSGPGPPRSLEPPGVGQLLRELQCQLNLPQAFPRRNLVQEARDAIVGTLQACHGCVPNLSLVLR 199
gi 1022962249 143 PtlGLPPKGKENEAPGGPTPEPPSP------RTLLEELQGQLHLPGAFPRRCLVQEARAEIIGALLAHYGELPDLSQVLR 216
gi 672035210  128 P--DLQSKGKENKVPGGSGPGPPNSPDLPVLGQLLEELQCQLVVPQAFPRRNLVQEARDTIIRTLQGCHGCVPDLALVLR 205
gi 554585031  133 P--GPQSRGKENQVPGDSGPGPPSPLELPGLGQLLGELQGQLILPQAFPRRNLVQEARDAILGTLQVCHGCVPDLTLVLR 210
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122133324  200 GCQPHLPGTDPGALKRqRMTPSWINSPEQAPGEGRQRRR--QGTKELTFAVPPTSSTPT-VHQVSLAPPKGPW-----PP 271
gi 187611337  194 GCQPPLPGAKPGVSER-KMTPFWINSPDQVPEQERQRKQ--QGTKEFTFPMPYTSSMPT-AHRGSLAPPRGPW-----PP 264
gi 532105239  195 GCHPPLPGTKPGISEKqRMTPSWINSPEQAPREERQRRL--RGTKELTFSMPHTSSPPV-THRVSLVPPGGPW-----PP 266
gi 513023688  229 GCQSPLPGTKPEVPERqTMTPSWINKPEQAAREGRQRRP--QRTKDI-FTMPHMSSTPT-AHRMSLEPRRGPW-----PP 299
gi 562824652  200 GCQLPLPGTKPGDLARrRSAPSWINTTEQAPGEGRQRRQ--QGTKEFTFAISHTSSAPT-THRVNLAPPRGPR-----PP 271
gi 344269303  207 ACQPPLPGTKPRDPERrRMTPSWINSPEQAPVEGRQRRR--RGAKELTFTMAHTSSTPT-AHRASLTPPRAPW-----PP 278
gi 395854080  200 DCQPPLPGAKPQGSEKrRMTPSWTNSSDQATG---QKRP--QGTKELTFTMPHTSSTPT-THRVSLAPPRGPW-----PP 268
gi 1022962249 217 GLREQGAGPEPQSPEEwQMVPQDREPPDQQALVESRRRRrrKGKRELMFTLGATPSPPS-TEK-SLVLPPDPWvpspsPP 294
gi 672035210  206 GCQLPLPEAKRRAPERqRMAPSCINAPEHAPREGRQRTQ--QATKGCNFALPHTCSSITpAHRVSQVQPPDRQ-----LP 278
gi 554585031  211 GCQPSLSGTKPGDSERrR-----INSPEQAPGEGRQRRRegQGTKEFTFAMPHTSSTLT-THRVSLAPPKGPW-----PP 279
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122133324  272 PLSSLPSPSGAAWGPPTAFDLLKSIWLVATPP---PPRPWGIGPPQLLPQPPSPLLPRSSALDWSPSPPAPLPSLSWMVA 348
gi 187611337  265 YFPSLSSPSGTAWGPPTAFDLLKSIWLVATPP---PPRPWGVGLPQPLPQPSSPLLPRTSVLDWSPSPPSPLPSLSWVVA 341
gi 532105239  267 TLPSLPSPSGAAWGPPTAFDLLKSIWLVATPP---LPRPWAVGPPQPLPQPLSPLLPRTSALDWSPSPLAPLPSLSWVVA 343
gi 513023688  300 SLP-LSSPSGTAWGPPTAFDLLKSIWLVGTPP---PPHHWCVGPPQPLPQP-SPLLPRTSDLDWSPTSPAPLPSLSWVVA 374
gi 562824652  272 LLPSLPSPSG-ALGPPTAFDLLKSIWLVATPP---PPQPWEVSPPQPLPQPPSPLLPRTAALDWSPSPPAPLPSLSWVVA 347
gi 344269303  279 PLPSLPSPSGAAWGPPTAFDLLKSIWLVATPP---TPRPWGIGPLQPLPRPPSPLLPRTSALDWSPSPPASLPSLSWVVA 355
gi 395854080  269 PLLSLPSPSGAALGPPTAFDLLKSIWLVATPP---TPRPWGVGPPRPLLHPPSPLLPRTSALDWSPSPPAPLPSLSWVVA 345
gi 1022962249 295 PLPLGSERGETTWGPQTSFDVLKSIWLPATPPtcaPPWQWGAG---GTAHPPA-CLPNSEALDWSPSPPAPMPGLPWFVS 370
gi 672035210  279 FLSSASSPSGAAWGPPTAFDMLKSIWLIATPP---PPQPWDVCPPQPLPQPSLPLLPRTSALDWSPNPPAPLPSLSWVVT 355
gi 554585031  280 TLP---STSPVAWGPPTAFDLLKSIWLVATPS---PSWPCGVSTPQSLPQLPSPLFPRTSALDWSPCPPAPLPNLSYTVA 353
                         410
                  ....*....|....*
gi 122133324  349 QSSPEAWSFPPMRLY 363
gi 187611337  342 QSSPEAWSFPPMRLY 356
gi 532105239  344 QSSPEAWSFPPMRLY 358
gi 513023688  375 QSSPEAWSFPPMRLY 389
gi 562824652  348 QSSPEAWSFPPMRLY 362
gi 344269303  356 QSSPEAWSFPPMRLY 370
gi 395854080  346 QSSPEAWSFPPMRLY 360
gi 1022962249 371 RSSPEPWTFPRMRLY 385
gi 672035210  356 QSSPEAWSFPPMRLY 370
gi 554585031  354 QSSPEaWSFPPMRLY 368
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap