Conserved Protein Domain Family
DUF4635

?
pfam15466: DUF4635 
Domain of unknown function (DUF4635)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 120 and 154 amino acids in length. There are two conserved sequence motifs: LEQ and DLE.
Statistics
?
PSSM-Id: 317818
View PSSM: pfam15466
Aligned: 10 rows
Threshold Bit Score: 160.371
Threshold Setting Gi: 395505071
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81905992    1 MTIQKTGCRGREAAE-----VVEQRRRSHh-------CD-----DRKQTLLALLILVLYLGMGIS--GSSWEVSGQTKDC 61
gi 268370259   1 MTIQKTGCRGREAAE-----VVEQRRRSHh-------CD-----DRKQTLLALLILVLYLGMGIS--GSSWEVSGQTKDC 61
gi 395505071   9 vwKRKADSSRRIVST----------------------SI-----DKKQSILILLILFLYLTMWLSasGKSWETSEGIQEC 61
gi 831212560   2 VI--QVGSRGRVAAQ-----LLEQRSNGH--------CE-----DKKQTLLALLVLVLYLGTGIS--GRSWEMSERIREC 59
gi 297295720   1 MATQQVGSRRRVAAErvaaqLLERRRDSH--------CD-----DKKQTLLALLILVLYLSTGIS--GSSWEVSERIREC 65
gi 351703867  14 TAVNKLPGACQNGVDtg--wVEQTHRAQFhrvenhltCPqwtrlEQEQMLFSLLVLVLYLGTGIS--GRNWEMYKRIREC 89
gi 348575209   1 MEFQQMDGRARVAAQ-----LFEQRRGSH--------CE-----DKKQTLFTLLVLVLYLGTGIS--GRNWEVYERIREC 60
gi 584036456   1 MVAQQVDNRRREAAE-----LLDHRRGSR--------CE-----DKKQTLLALLVLVLYVSSGIS--GRSWEMSERIREC 60
gi 545495804   1 MVTQQVGSRGRVAAE-----LFERRRGSR--------CE-----DKKQTLLVLLILVLYVGTGIS--GRSWEVSERIREC 60
gi 731455854  15 MVIQHVGNRARVGAE-----LLE-RTDSR--------SE-----DKKQSLLALLVLVLYLGTWIS--GRSWEVSERIRGC 73
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 81905992   62 NHFQNPVTPQGFEYQTKEPAEEPLRTLRKWLKINLHGFLEKLEKEVRELEQLVRDLEFWLDALLGD--LRPEDPCF 135
gi 268370259  62 NHFQNPVTPQGFEYQTKEPAEEPLRTLRKWLKINLHGFLEKLEKEVRELEQLVRDLEFWLDALLGD--LRPEDPCF 135
gi 395505071  62 NFYQNHGTSKNLENQLKDQPKEPTKAMGKWLRESLDILQERLERELRVLEQQVKDLEEWLDYHLKD--LGSEEKCG 135
gi 831212560  60 KCYQNPVISQGLEYQTSEPSEEPIRVIRTWLKENLHVFLEKLEKEVRELEQLVRDLELWLDALLGEsqPYPEEPCc 135
gi 297295720  66 NYYQNLVVSQGLEYQTDEPSEEPIKTIRNWLKENLHVFLEKLEEEVRELEQLVRDLELWLDALLGE--PHLEEHCS 139
gi 351703867  90 NYFQNPVASQEFEYQTSEPSKEPIKLLRNWLKNSLHVFLEKLEEEVQELEQLVQDLELWLDALLSD--PYLEEPCS 163
gi 348575209  61 NFSQNPLASQGYGYHTRQPSEEPIKLLRDWLKKGLHVFLEKLEEEVQELERLVWDLELWLDALLGE--PCLEEpys 134
gi 584036456  61 NY-QNPVASQGFEHQTKDPSKEPLKVVRTWLKENLQVFLEKLEKEVRELEQLVRDLEEWLDVLLGE--GRPEESCS 133
gi 545495804  61 NYPQNPVASQGFEYQTNEPAEEPIKVIRTWLKENLHVFLEKLEKEVQELEQLVQDLEEWLDALLGD--GHAEDPCS 134
gi 731455854  74 NYPENTVATQGLEYQTNDGSEVPVKFIRHWLKENLHVLLEKLEEELRELEQLVRDLEEWLDAILGE--AYLEEPCS 147
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap