Conserved Protein Domain Family
SGIII

?
pfam15467: SGIII 
Secretogranin-3
Secretogranin_3 is a family of vertebrate proteins that is one of the granin family. Granins are rich in acidic amino acids, exhibit aggregation at low pH, and possess a high capacity for calcium binding. Because granins are restricted in their localization to secretory granules of neuroendocrine cells, two interesting characteristics of their sorting mechanisms have been observed. These are, first, that they aggregate on low pH/high calcium concentrations and second that two of them carry an N-terminal disulfide loop, mutations in which lead to mis-sorting. Thus, granins are thought to be essential for the sorting of secretory proteins at the trans-Golgi network. Chromogranin A (CgA) binds to SGIII in secretory granules of endocrine cells. SGIII directly binds to cholesterol components of the secretory granule membrane and targets CgA to secretory granules in pituitary and pancreatic endocrine cells. Mutations in the SGIII gene may influence the risk of obesity through possible regulation of hypothalamic neuropeptide secretion.
Statistics
?
PSSM-Id: 317819
View PSSM: pfam15467
Aligned: 9 rows
Threshold Bit Score: 721.193
Threshold Setting Gi: 551496480
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 387935388  19 INAFPTP-AGPD-DK--YNRELTEEKPLEQQI--AEADSIR---KTESKPTPPAEEETn--SEDDDITFLKALAEKSK-E 86
gi 387935422  18 VQGFPNP-GIKQ-DKavHNRELSEERPLEEQI--AEADTVS---RGTSKENQEMLKND---SFADELGLLMSVAEKEGdV 87
gi 972961811  22 LNAFPTP-DVTS-DKavYNRQLSEERPLQEQI--AEADSVS---KSVAKDNQSASTEPtidPDNDDFSLLRSLAETSK-D 93
gi 402874319 129 IQAFPKP-GGSQ-DKslHNRELSAERPLNEQIaeAEADKIK---KTYPLENKPGQSNY---SFVDNLNLLKAITEKEKmE 200
gi 637342238  19 GHSFPKPeGARS-DKaiHNRELSVERPLEEQIaeAEADKMK---KATSKENKPEFRNY---SFAEDLNLLKSAVEKER-- 89
gi 556996976  61 VFAFPVP-DGAK-DKavYDRELSVERPLQEQi--AEADWAS---KTVNTESKADSKNI---SDADNFNLHKNLKENKRnE 130
gi 551496480  23 TSAFPTPtASAD-DKtvYNRQLTEERPLQEQI--AEADSVKaavQSAESKQPATSKDAe-sEQGDDFTMLKSLADGQK-S 97
gi 765114846  23 VYAFPTPsASTDaDKsvYNQQLTEERPVQQQI--AEADSVKaalQSAGGQHPAASKESd--QDSDDFTMLKSLADGQK-S 97
gi 47230642   21 GSGFPTPtPSSD-DKtgYNRQLTEERPIQEQI--AEADSVKaaiQVAETKPAASSQDA---QDLDDLTVLKSLADGQK-P 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 387935388  87 SNNETPISDSANERLGADDTDSTKNRRLADDYDSTKNGMDYky-qDDPESFRQLDGTPLTAQDIVQKIANKIYEEDDRGV 165
gi 387935422  88 KRSGSVRSSVGGHRGTLDDADSTKNLKPAEYFDSTKSMLDYky-eDDPDGLHQLDGTPLTAEDIVRKIATRIYEENDRGV 166
gi 972961811  94 LGSKTPSSKSINTHYFPDDADSTKNRRLVDDYDSTKNGMDYry-qDDPDGLHQLDGTPLTAEDIVQKIATRIYEEDDRGV 172
gi 402874319 201 KERQSIRSTPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHkf-qDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRAV 279
gi 637342238  90 KEKASVRSSLYDQQLALDDADSTKSRRLVDDYDSTKSGLDYky-qDDPDGLHQLDGTPLTAEDIVQKIATRIYEENDRGV 168
gi 556996976 131 KKSGST-NKSFNDQSFFDDTDSTKNRRLVDDYDSTKSGSSYks-qDDPDGLRQLDGTPLTAEDIVEKIATRIYEENDRGV 208
gi 551496480  98 KEAPEGPVKKGDHQYVPDESDSTKSRRLADDYDSTKNGMDY----DDPESFRQVDGTPLTAEDIVQKIANKIYEEDDRGV 173
gi 765114846  98 KEPSVVPVKK-DDQYVPDESDSTKSRRLADDYDSTKKGMDYgkyqDDPESFRQVDGTPLTAEDIVQKIANKIYEEDDRGV 176
gi 47230642   94 KEGAEKEKKEAEEQYVPDESDSTKSRRLVEDYDSTKNGMDDgkyqDDPESFRQVDGTPLTAEDIVQKIANKIYEEDDRGV 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 387935388 166 FDRIVSKLLKLGLITDSQAETLEYEVAEALQDLITKNAKDNMIGDRSvdyPVSAAK--DTQDEED---RPSPR------- 233
gi 387935422 167 FDKIVSKLLNLGLITESQAYTLEDEVAEVLQQLIANEAKNREKEAGDldyAAVRSDvyDDDKQEGkmeTRNKN------- 239
gi 972961811 173 FDRIVSKLLNLGLITESQADTLEYEVAEALQQLIANQVKNNEIEDTSmdyPASSTE--DPGEKQEksvSEKAS------- 243
gi 402874319 280 FDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYE---EDlnkPTSRTEn-QAGKIPEkvtPMAAI------- 348
gi 637342238 169 FDKIVSKLLNLGLITESQAYTLEDEVAEVLQQLIANEAKDREKAAEGldyLPSKTDmnTNQNLEEkmvPKAPE------- 241
gi 556996976 209 FDKIVSKLLSLGLITESQAYTLEDEVAEALQQLITNEAKNNERESESfdnHPIRTGgdLKEKQEEkmlLEKPH------- 281
gi 551496480 174 FDRIVSKLLKLGLITENQADTLEYQVAEALQDLITKNAKNNEVEDMD---QESRGEqdDLGPDTDaweTPRRR------- 243
gi 765114846 177 FDRIVSKLLKLGLITESQADTLEYQVAEALQDLITKNAKNNEIDDIEsidQAAGGEqeDQDS-DTgtwEPPKRrynekee 255
gi 47230642  174 FDRIVSKLLKLGLITDSQADTLEYQVAEALQDLITKNAKNNEIEDTEsndRDVRGEqdDQGSDTNvdtWEPPR------- 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 387935388 234 ----------------------F---------------------------DEEDEVENEggDDANgdepqeeesrddtvr 264
gi 387935422 240 ----------------------E---------------------------DRESSETKN--EDSF--------------- 253
gi 972961811 244 ----------------------R---------------------------RYEDQHVSEdvd----------------dt 258
gi 402874319 349 ----------------------Q---------------------------DGLTKGEN---DETV--------------- 361
gi 637342238 242 ----------------------Q---------------------------D-----------DTL--------------- 246
gi 556996976 282 ----------------------K---------------------------DGQSELMNEdiDDTL--------------- 297
gi 551496480 244 ----------------------Y---------------------------DEEDHDEVAnnDDEIadevdr----dveed 270
gi 765114846 256 daaeaddedvedevereaeedvN---------------------------EA---------------------------- 280
gi 47230642  247 ----------------------GrynededegqeedeeeeevedevdrdvGEDERETA---------------------- 282
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 387935388 265 sDDSwdavsdgNDRNELNPEDGLQDLQFFPNFYRLLKSLDSEQDKEERETLITIMKTLIDFVKMMVKYGTITPEEGVTYL 344
gi 387935422 254 -SSK-------ERRNELSPEEDFDDLQYFPNFNRLIKSLNSENDAKEKKTLITIMKTLIDFVKMMVKYGTITPEEGVNYL 325
gi 972961811 259 vDNTwappneaDQRNELSPEDSLQDLQYFPNFYNLLKSLNSEQDAKEKETLITIMKTLIDFVKMMVKYGTITPEEGVSYL 338
gi 402874319 362 -SNTltltnglERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYL 440
gi 637342238 247 -DNTwassnilERRNELPPEDNFEDLQYFPNFYELLKSLNSEKEAKEKETLITIMKTLIDFVKMMVKYGTITPEEGVSYL 325
gi 556996976 298 -GNSwtfpnsmERRNDLSPEDDFEDLQYFPNFYNLLKSLNSEADKKEKKTLITIMKTLIDFVKTMVKYGTITPEEGVSYL 376
gi 551496480 271 mDNSwdk--ekEEGNEVNPEDGLQDLQYFPNFYRLLKSLDSEQDAQERETLITIMKTLIDFVKMMVKYGTITPEEGVSYL 348
gi 765114846 281 -GDTwek--gtEDGNEVSPEDGLQDLQYFPNFYRLLKSLNLEKDTQERETLITIMKTLIDFVKMMVKYGTITPEEGVSYL 357
gi 47230642  283 -GNSwdk--nmQQGNEVNGGDGLQDLQYFPNFYHLLRSLDSERDTQERETLITIMKTLIDFVKMMVKYGTITPEEGVSYL 359
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 387935388 345 ENLDAMIALQTKNKLGKSLVp-lSITPPTG--KAADDDDNTKTEAAKMQKEYESLKDSTKDVQTAA--EISHP----GKS 415
gi 387935422 326 ENLDAMIAVQAKNKLGKSFG---SHKSILSedKNVDESDSTKQEAAKMEKEYEALKDSTKPEPKDAe-DKDKPk---GKA 398
gi 972961811 339 ENLDAMIALQTKNKLGKSLVt-sDIRAPTd--KTSEEEDNTKEEVAKMEKEYESLKDSTKEEQAVP--ESGSS----GKT 409
gi 402874319 441 ENLDEMIALQTKNKLEKNATdniSKLFPAPseKSHEETDSTKEEAAKMEKEYGTLKDSTKDDNSNPggKTDEPk---GKT 517
gi 637342238 326 ENLDAMIALQTRKKLEKP-----GTKAKLLsdKSTEESDSTKAAAAKMEKEYETLKDSTKIEEQNTe-NDEEPk---GKA 396
gi 556996976 377 ENVDAMIALQTKSKLGKPLAy-pTDKEPAe--WSNEETDSTKEEADLMEKDSESLKDSTKKEGQKIsvKDEEPkgslGKS 453
gi 551496480 349 ENLDAMIAMQTKNKLGKSLVv-pDISGLTG--KNFDEDDNTKSETAKMQKEYENLKDSTKEEQTST--ETNQP----GKS 419
gi 765114846 358 ENLDAMIAMQTKNKLGKALGl-pDVTAPSe--KDWDDDDNTKAEAAKMQKEYENLKDSTKEEQPPT--ETNQP----GKS 428
gi 47230642  360 ENLDAMIAMQTKNKLGKSLGt-tDFMGPNG--RNLEEDDNTKAEAAKMQKEYENLKDSTKEEQPSTa-TTDQP----GRS 431
                        490       500       510       520       530       540
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 387935388 416 ESYLEAIRKNIEWLKKHNKEGNK--EDYDLSKLRDFMDQQVDSYIDKGILEKDEGDVIKRIYGSL 478
gi 387935422 399 ETYLEAIRKNIEWLKEHNKEGNKgvSDNDLSKLKDFINQQADSYVEKGILDKEEANVIKRIYSSL 463
gi 972961811 410 ETYLEAIRKNIEWLKKHNKQGNK--EDYDLSKLRDFMDQQVDSYIDKGILEKDEGEIIKRIYSSL 472
gi 402874319 518 EAYLEAIRKNIEWLKKHDKKGNK--EDYDLSKMRDFINQQADAYVEKGILDKEEAEAIKRIYSSL 580
gi 637342238 397 EAYLEAIRKNIEWLKKHNTQGNK--EDYDLSKLRDFIDQQADAYVDKGILDKEEADVIKRIYGSL 459
gi 556996976 454 ESYLEAIRKNIEWLKKHNKQGNK--EDYDLSKLRDFIDQQADTYVEKGILEKEEADVIKRIYSSL 516
gi 551496480 420 ESYLEAIRKNIEWLKKHNKDEGK--NDYDLSKLKDFMDQQVDSYIEKGIIAKDEGDTIKRIYSSL 482
gi 765114846 429 EAYLEAIRKNIEWLKKHNKEDGK--EDYDLSKLKDFMDQQLDSYIDKGIIAKEEGDTIKRIYSSL 491
gi 47230642  432 ETYLEAIRKNIEWLRKHNKEESK--DDYDLSKLKDFMDQQVDAYIEKGIIAKEEGDTIKRIYSSL 494
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap