Conserved Protein Domain Family
TMEM171

?
pfam15471: TMEM171 
Transmembrane protein family 171
This family of proteins is found in eukaryotes. TMEM171 is also known as parturition-related protein 2. Proteins in this family are typically between 242 and 326 amino acids in length.
Statistics
?
PSSM-Id: 317822
View PSSM: pfam15471
Aligned: 15 rows
Threshold Bit Score: 485.008
Threshold Setting Gi: 514711843
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81863805    4 VGTAEPDGDQRDRQVSKLIFFLFVFGAVLLCVGVLISIFGYQACQYKPLSHCSMVLKIAGPSCAVMGLGTVILARSRARL 83
gi 115311873   4 AAAAEPDGDQQDRHVSKLIFCFFVFGAVLLCVGVLLSIFGFQACQYKPLPDCPMVLKVAGPACAVVGLGAVILARSRAQL 83
gi 334325271   4 ATAPEPGGDVSGRRISKIIFFLFVFGVVLLCAGILLSIFGFQTCQYETLIDCSAVLKIVGPSCAVIGLGTIILARSRAKL 83
gi 831219231   4 TAAAEPDGEQQDRLVSKLIFFFFVFGAILLCVGVLLSIFGFQACQYESLPHCSMVLKVAGPACAMVGLGAVILARSRARL 83
gi 513023368 120 IAIAEPDGDEQDRGASKLIFFLFVFGAVLLCVGLLLSIFGYQACQYEPLPDCNMVLKIAGPSCAVIGLGAVILARSRARL 199
gi 532086595   4 TATAEPEGDQQDRHVSKLIFFLFVLGAVLLCVGVLLSIFGYQACQNESLPDCSMVLKIAGPSCAVIGLGTVILARSRARL 83
gi 655882523   4 EAATEQDR-ERGRRVSRIIFFLFVFGAVLLCVGVLLSIFGFQACQYETVSDCSLVLKIAGPSCAVMGLGAVILARSRARL 82
gi 514711843   4 VAVPAPGDERNNGQHEKVTFFFFVFGAVFLCAGFLLLVFILQSCPYETFTDCNGVLKASGPVLVVAGLVFVLLAKSRARL 83
gi 513229825   4 VTVPVPVGEANNGQHKKATFFLFLFGAILLCGGFLLSVFTLQSCPFETFSDCSGVLKASGPVLGVTGLLCILIARSRARL 83
gi 731464456   4 SAATEPSEHQHYRHVSKLIFLLFVFGAILLCVGVLLCIFGFQVCQYEAFLNCAPVLKAIGPMCAVIGLGTVILARSWARL 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81863805   84 QLRERQRQGHQ-DPDQSFFCGESRQFAQCLIFGFLFLTSGML-----ISILGIWVPGCGSDWAQEPLNETNSGEGEPQIC 157
gi 115311873  84 QLRAGLQRGQQmDPDRAFICGESRQFAQCLIFGFLFLTSGML-----ISVLGIWVPGCGSNWAQEPLNETDTGDSEPRMC 158
gi 334325271  84 QLRERQLQGNQvDPDTFFLCGESRQFAQFLIFGFLFLTSGML-----ISVLGIWVPGCNPGWPQPPFNDTDASSTEPQAC 158
gi 831219231  84 RFHQGRRQGHQaDPDQAFICGESRQFAQCLVFGFLFLTSGML-----ISVLGVWVPGCGSGWEQEPLNDTDSADEEPQIC 158
gi 513023368 200 QLLVRRRQGNQvDSDQAFLCGESRQFAQCLIFGFLFLTSGLL-----VSILGIWVPGCSSDWAQDLLNETDTISAEPQIC 274
gi 532086595  84 QFLQGRRRGDQaDPNQAFICGESRQFAQCLIFGFLFLTSGML-----ISILGIWVPGCSSDWVSESLNQTETASMEPPIC 158
gi 655882523  83 QLLEGQRRGSQaDPDQAFICGESRQFAQCLIFGFLFLTSGML-----ISVLGIWVPGCGMNWVQDSLNETDSAGAGPPIC 157
gi 514711843  84 HIRQRQLQNEQv--YGLVFCRGSCQFAQFLIFGFLFLTSGTLxsgtlISILGIWVPGCSPGWHSVLLNQTHSSDVNLQGC 161
gi 513229825  84 YISQRQLQNEQi--CSLFFCRGNCQFAQFLIFGFLFLTSGML-----ISILGIWVPGCSPGWPNIQLNQTSSSDGDLQGC 156
gi 731464456  84 QVLEGQLQDNQvDPNGAFICGESRQFAQYLIFGFLFLTSGML-----ISILGIWVPGCGSGWAQEPLNETDTTDSEPRIC 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81863805  158 SFLSLQIMGPLIVLVGLCFFVVAHVKKKSNLSSSRDTSEIEGGHTHSTEPVHITVGDSVIIFPPPPPPYFAESSAAA--- 234
gi 115311873 159 GFLSLQIMGPLIVLVGLCFFVVAHVKKRNTLNAGQDASEREEGQIQIMEPVQVTVGDSVIIFPPPPPPYFPESSASAv-a 237
gi 334325271 159 GFLSLQIMGPLIVLIGLCFFVVAHIKKRHDLNSSQDSSESEERRSQNNEPVQVTVGDAVIIFPPPPPPYFSDASTSAvat 238
gi 831219231 159 GFLSLQIMGPLIVLVGLCFFVVAHVKKRNELNADQDAPDREERQTQSTEPVQVTVGDSVIVFPPPPPPYFSESSAAAv-t 237
gi 513023368 275 GFLSLQIMGPLIVLMGLCFFVVAHVKKKNNLSVSQDASESEEGHGPSTEPVQVTVGDSVIIFPPPPPPYFPESSTSAg-s 353
gi 532086595 159 GFLSLQIMGPLIVLVGLCFFVVAHIKKRNNLSVSQDASESEEGHTHNMEPVQVTVGDSVIIFPPPPPPYFPESSASAg-t 237
gi 655882523 158 GFLSLQIMGPLIVLVGLCFFVIAHVKKRNNLNVSQEAPESEEGQAQSMEPVPVTVGDSVIIFPPPPPPYFPGSSTAAd-t 236
gi 514711843 162 GFLSLQILGPMIVFTGLCFFVIAHVKK-QNFGLSEGSIESEE-HPQSTEYFQVTAVDATMVFPPPPPPYFADPMSPSv-t 238
gi 513229825 157 GFLSFQILGPLIVLTGLCFFVIAHVKKKQNLNLNEESLENEE-RPQSPESFQVTLGDAVLMFPPPPPPYFADPLSPAv-t 234
gi 731464456 159 GFLTLQIMGPLIVLVGLCFFVVAHVKRRNRLSVGQDASENEEGQTQSTESVQVTVGDAVIIFPPPPPPYFPEPSASAv-t 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81863805  235 PSPGANSLHRIENPPSYSSLFNLSRTPTPEnqGAASERDREVIYTISGPGSSSESSHT--GHLPLDLPPRYEEKETAPAT 312
gi 115311873 238 ESPGTNSLLPNENPPSYYSIFNYGRTPTSE--GAASERDCESIYTISGTNSSSEASHT--PHLPSELPPRYEEKENAAAT 313
gi 334325271 239 HSSASNNLPPSENPPSYYSIFNYG-TQTSEveGAVSYRNPESIYTISGTNLSSETSLA--SHISSELPPRYEEKETVNVD 315
gi 831219231 238 RSPGANGLLPNENPPPYYSIFNYGRTPTPEsqGTVSERNRESVYTISGTSPSFEISHT--PHLSSESPPRYEEKDNTAGT 315
gi 513023368 354 QSPGANSLLPTDSPPPYFSLFSHGRTSALEnqDTAHEQEHEFVYTISGPHSPPEITHA--PRVLLELPPRYEEKETPTAT 431
gi 532086595 238 RSPGANSLLPTESPPSYYSLFNDGRTPAPEsrGQAPERPREFVYTISGPPARSDFSHT--PHPSSEPPPRYEEKEHAPNT 315
gi 655882523 237 PAPGAGAVLPGENPPPYYSIFNPG-TPAPEsqGEPSDRDCGFVYTISGTDSSPEVSHT--PYLPYELPPRYEEKDSSA-- 311
gi 514711843 239 PCLMSSGFPASENPPPYESIFNDG-AQFADddRTVAARDYEAACTISGYSSLSDILPMfpMSLSSESLPEYEDKVSVTSN 317
gi 513229825 235 HCLMSSVLPASRNPPPYHSVFSDG-AQFADdeRTVAARDDETIYTISGCSSPLGISPV--QFFSSEPPPDYEEKASVESN 311
gi 731464456 238 QTAPANSLLPNESPPSYYSIFNYGRTPTPEdqGTASERDHGSVYTISGTRPSSEILPT--PHLPSESPPRYEEKETTAAT 315

                 ....*.
gi 81863805  313 PLGAPS 318
gi 115311873 314 FLPLSS 319
gi 334325271 316 HLTsss 321
gi 831219231 316 PLSPSS 321
gi 513023368 432 SLSLPS 437
gi 532086595 316 SLSPSS 321
gi 655882523 312 ---PAS 314
gi 514711843 318 ECSLTS 323
gi 513229825 312 EYSLSS 317
gi 731464456 316 ALSPSS 321
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap