Conserved Protein Domain Family
DUF4639

?
pfam15479: DUF4639 
Domain of unknown function (DUF4639)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 161 and 601 amino acids in length.
Statistics
?
PSSM-Id: 317830
View PSSM: pfam15479
Aligned: 16 rows
Threshold Bit Score: 765.127
Threshold Setting Gi: 432108060
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940555    6 SRQAR-DRGVTRSKAEKARPPTQPVPQVDIVPGRLNEAEWIAFMSLEEGEDVVGDILADLMTRVMECAFKVYLTQQCVPF 84
gi 222831618    6 SRQAR-DRGVTRSKAEKARPPTQPVPQVDIVPGRLNEAEWIAFMSLEEGEDVVGDILADLMTRVMECAFKVYLTQQCVPF 84
gi 281343065    4 ERQIR-DRGVTRSKAEKARPPAVQVPQVDIVPGRLTEAEWMALMALEEGEDVVGDILADLLSRVMDSAFKVYLTQQCVPF 82
gi 349585094    9 ERQAR-DRGMTRSKAEKVRPPTVPVPQVDIVPGRLTEAEWMALSVLEEGEEVVGDILADLLARVMDSAFKVYLTQQCIPF 87
gi 222831616    6 PRQVR-DRGMTRSKAEKVRPPTVPVPQVDIVPGRLTEAEWIAFTALEEGEDVVGDILADLVARVIDSAFKVYLTQQCIPF 84
gi 731493342    6 sRQAR-DRGVTRSKAEKARPPTVPVPQVDIVPGRLNEAEWMALAAIEEGEDVVGDIIADLLARVMDSAFRVYLTQQCIPF 84
gi 831231888    9 ERQMRgDRGVTRSKAEKARPPTVPVPQVDIVPGRLNESEWMALTALEEGEDVVGDILADLLARVMDSAFQVYLAQQCIPF 88
gi 562844649    9 ERQVR-DRGVTRSKAEKVRPPTVPVPQVDIVPGRLNEAEWMALMALEEGEDVVGDILADLLARVMDSAFKVYLTQQCIPF 87
gi 1040206987   9 ERQAR-DRGVTRSKAEKARPPTVPVPQVDIVPGRLNEAEWIALTAVEEGEDVVGDILADLLARVMDSAFKVYLTQQCVPF 87
gi 625268734    6 SRQVR-DRGVTRSKAEKARPPTQPVPQVDIVPGRLNEAEWIAFMSLEEGEDVVGDILADLLTRVMECAFKVYLTQQCVPF 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940555   85 TISQAREAMLQITEWRFLARDEGESAVAEDPTWGEDEEPLACTTDSWAQGSVPVLHTPAPVCVEEQFHNEEPGNPDQFLL 164
gi 222831618   85 TISQAREAMLQITEWRFLARDEGESAVAEDPTWGEDEEPLACTTDSWAQGSVPVLHTPAPVCVEEQFHNEEPGNPDQFLL 164
gi 281343065   83 TVSQAREAMLQITEWRFLARDEGESAVAEDPTWGEDEEPFACTTDAWAQGSVPVLHAPAFMGPEDTFQGEDQGRVm---- 158
gi 349585094   88 TISQAREAMLQITEWRFLARDEGETVVAEDPTWGEDEEPSACTTDAWAQGSVPVLHAPTSVGLEETFPGEDRGSVDQITL 167
gi 222831616   85 TISQAREAMLQITEWRFLARDEGESAVAEDPTWGEDEEPLACTTDAWAQGSVPVLHARASMGLEETFQGEDQDSVDQIPL 164
gi 731493342   85 TISQAREAMLQITEWRFLARDEGESAVADDPTWGEDEEPLACITDAWAQGSVPVLHAPASVGPEETLQ-EDRGSVDRSPL 163
gi 831231888   89 TISQAREAMLQITEWRFLAHDEGESAVAEDPTWGEDEEPSPCTTDSWAQGSVPVLRAPTLEGPQENLQGEGPRNLDQMPL 168
gi 562844649   88 TISQAREAMLQITEWRFLARDEGESAVAKDPTWGEDEEPLACTTDSWAQGSVPVLHTPAAEGMDETLQDED-------PL 160
gi 1040206987  88 TISQAREAMLQIAEWRFLARDEGESAVAQDPTWGEDEEPLPCTTDAWAQGSVPVLHGRLSEGQEETFQSEDTESQDQSPL 167
gi 625268734   85 TISQAREAMLQITEWRFLARDEGESAVAEDPTWGEDEEPLACTTDAWAQGSVPVLHAPAPVGVEEHFQGEEPGNSDRFLL 164
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940555  165 GSSW-DKESQKPTQPSEPSA-EPKVTPRPTATL--------EAFEEAEPGDALE--VPHGQEGS-----------HMlav 221
gi 222831618  165 GSSW-DKESQKPTQPSEPSA-EPKVTPRPTATL--------EAFEEAEPGDALE--VPHGQEGShmla----vpsKE--- 225
gi 281343065  159 -----ARGSQEQMESWEHSp-eLQFTPGPPPTP--------ELFQETGSRGPLV--DLDIQARDhqat---vrslNV--- 216
gi 349585094  168 GRSWmDTGSQEPMEPWDRClpeQRVVP--SSTL--------ELLKETGPRGPLEelELDGQARGhlss---vgclTV--- 231
gi 222831616  165 GGSWtDSGSQEPMESWe-----LTVTPDSPPTP--------ELLQETGPRSPLE--KLGDQSRSdqtdlfavgssNS--- 226
gi 731493342  164 KRSWvGRGSQEQMESLERS---------PEPGAcpgpppapELFQEAGPGEPLE--ELDDQERGavss---aescNA--- 226
gi 831231888  169 GRSRmSRGSQELRQPWEPSq-eVRINPSTPPMP--------DVFQEAGPRDPLE--EPDplit---------kslNK--- 225
gi 562844649  161 GKPWiERDSQEEAESQe-----LRVTPGPVPTA--------ELFQEAEPGGSFE--EPVDQMRDppss---agslSA--- 219
gi 1040206987 168 GRLWlDRHSQGQTGSWEPSp-eLRATSGRPLTP--------EPFPEAGPGDVLE--EADShlss-------aeslH---- 225
gi 625268734  165 GSPWlDRDSQEPTASSQPSa-eTRVIPGLTPTL--------EEFQEAEPQDDFE--EPDGQEQSdvlvtslkepsHIltg 233
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940555  222 pSKEslrStaeGERVYSPQSSLKQPQVVRLQASEKESS-FGSHLSLEDLYLCMPQPDAAGDRLSLQSKG--QLHSSPIGS 298
gi 222831618  226 -SLRstaE---GERVYSPQSSLKQPQVVRLQASEKESS-FGSHLSLEDLYLCMPQPDAAGDRLSLQSKG--QLHSSPIGS 298
gi 281343065  217 -SRQ---PsveLAPDGSPHPSLELSQVASTQTLARRAQpRGSQSLLEDLHYCTSQPHVAGDGLKCKKEDvpRISSGVSGA 292
gi 349585094  232 -SSQ---LsmeMAVAGGPHLSLEPTPVASPKGSVEKAQpFSSPFSLEDLYYCTPQAQAAGDRMEPKKEEvpFISSSGSVS 307
gi 222831616  227 -SSQ---LsmeMVPAGSTHASLELSLVASPQASVERAQpISSQFSLEDLYNCTPQPHAAGDRLELREEKvpLIPSRVLVS 302
gi 731493342  227 -SFH---PseeMASAGSPEPSEEEFLEAGSQTPEETGQpLSNQLSLGDLYYCAPQPDEAGDRAELEKEGvsPIASGTLLS 302
gi 831231888  226 -SFQenfQsvqVASADSPGP-LELSLVASPKALAKTVQpFDSQV-LENLCYGLPQVDAAEDQLELKTKGvpRAASGV--P 300
gi 562844649  220 -CFQ---PcaeGAPADSPPTPPELSRLASPQASTPSGQfLKSQLSLEDLRYCTSQPDAAGDRPELKTAGapYVASGVSAS 295
gi 1040206987 226 -SFQl--PwveVGPREGPHPSLELSQVASPQAPALRPQs-GSLLSLEDLYYCMPDKDAAGDRMELKREElpPVASAAALS 301
gi 625268734  234 pSKQsspPs-----AHSPQLSLDLPHVVSLQISEKGSSsLSSHLSLEDLYNGLPQPDAAGDRLKRESKGtpRAPS--VGS 306
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940555  299 ESHLGALTPAEPSAFqe----------pEVLGER------------PKHK-TTTLRMDSSRLPRHWVRPVAEVLIPDLEV 355
gi 222831618  299 ESHLGALTPAEPSAFqe----------pEVLGER------------PKHK-TTTLRMDSSRLPRHWVRPVAEVLIPDLEV 355
gi 281343065  293 GLSSGSSTTLSRFASleprqprftdalrSGLPYR------------MGLK--AGACLDPTRLPRHWVRPLAEVLVPDSEA 358
gi 349585094  308 GTSAGGLSTLSSSSGfqpqqlwrpdarpSSLRGR------------IGPS-AEMERLDPARLPRRWVRPLAEVLVPNSEM 374
gi 222831616  303 DPSAGGPTTLNPSAGfqpqppwlaeerpSALHSR------------IGRK-GTTARLDPARLPRPWVRPLSEVLVPDSEG 369
gi 731493342  303 CPSVDSPTRLSPSASlws------------qqpRraeawldalhhrAGGKvGGTARLDPARLPRHWVRPLAEVLVPGTEA 370
gi 831231888  301 VPTVGSPTRFSPSASvqpqwplsldvqlSMPPYR------------AR---KAATRLDPARFPRQWVRPLAEVLIPDSEA 365
gi 562844649  296 GTSLGDPTQISPSASfqsqqpggwnawpRTPHPR------------PGRK-PTVARLDPARLPRHWVRPLAEILIP-DDA 361
gi 1040206987 302 VGSEDRPTQLGPSVPfrwqqpgrwharlNPPRSR------------MDRR-ATRRRLDSARFPRHWVQPLATVLIPSSER 368
gi 625268734  307 VSLLSALTLERPSWSql----------pECLDSP------------QTRK-MPMVRLDPARLPRRWVRPVAEVLIPETET 363
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940555  356 HPLEIYRGRPR---RS-QAgtaTSACESQALSSRAP-----SkphvsSPRFPLQRCATF-RALGPD-----PSLNLAQTS 420
gi 222831618  356 HPLEIYRGRPRr-sQAgTA---TSACESQALSSRAPskphvS-----SPRFPLQRCATF-RALGPD-----PSLNLAQTS 420
gi 281343065  359 RHLEAYRGRRRv-aKT-KAsqpSARPLASGPGVRVS-----P-----TVFFSLPPSTPF-HALGRSpglqsPTLSLGLPS 425
gi 349585094  375 RPQKAYRGCLQs-rKT-EA---PAGPQAPGPDVRVS-----P-----SVFYPLPPGVPF-RALAPGrrlqfPTLSSGLPS 438
gi 222831616  370 RPLEAYRGRQRg-eKT-EA---PAGPQASRPSCRVS-----R-----SEFFPFPPGVPV-RTLGPGlslqfPTLNLGLPS 433
gi 731493342  371 CLLEAYRGRRRn--KT-DA---RATPQAREHGHRVS-----P-----AAFVPLRPGVPF-HALDSRlglqfPSLR----S 429
gi 831231888  366 HPLETYRGHQHsseKT-QT---PAEPQSPIPGASVF-----Q-----AAFFPFRSGVPF-RALGPGpkvqsSTLNLNLPS 430
gi 562844649  362 GPLESYRWRPQs-gKT-EG---RDTSLGSDAAAPVS-----P-----EAFVPLRLGVPSqRSLVNGsglqfHTVNLGLPS 426
gi 1040206987 369 YSMEAYCGHQQs-kKT-KA---QAVPQFPGPGDCTS-----P-----AMFFSLHPGTPF-RPLGRGrrlkfPTSNLGPLE 432
gi 625268734  364 RPLEIYRGRPRg-eKS-QAgarTPASRSQALGLHAP-----PklqasPLKFPLPCNAPF-RALGPD-----PTLNLAQSA 430
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 341940555  421 PSFGSNVPFLSPGFRFLPRNPIPPDVASTPTPKLWPLAKWPSGWEREAEQLGELWAGRTRVPPQGQEPVEVTPlEEDSGW 500
gi 222831618  421 PSFGSNVPFLSPGFRFLPRNPIPPDVASTPTPKLWPLAKWPSGWEREAEQLGELWAGRTRVPPQGQEPVEVTPlEEDSGW 500
gi 281343065  426 PGFGSKLPFPRPGLGFLATHLAFPDLARSPSPKLWPGAKWPSGWEGEAELLGEVWAGRSRVNPQGLDPRDREG-QdPHRW 504
gi 349585094  439 PGFGSKLPFPSSRLRFPITHSVLPDVAHSPSPKLWPGAKWPSGWEGEAELLGELWAGRTRIPPQGLDPGYRES-QdPHKW 517
gi 222831616  434 PGFGSKLPFPSPGLRFLATHRARPDMARSPSPKLWPGAKWPSGWEGEAELLGELWAGRTRVPPQGLDLGDRES-QdPHQY 512
gi 731493342  430 PVLVSKMPFPSPGLRFLTTHPTLPDVARSPSPKLWPSAKWPSGWEGEAELLDELWAGRTRVPPQRLDPGDRKG-QdSRGW 508
gi 831231888  431 PTFGSKIPFPSPGLRFLTKRPKLLDVAHIPSPKLWPSAKWPTGWEGEAEMLGDLWAGRTPVSAQGLEPTYREG-QdLQRW 509
gi 562844649  427 PPFRSKIPFPSSGLRFLATHRALPALPHSSSPKQWPSAKWPRGWEAEAEQLCELWAGRTRVPPQGPRPTE-EG-QgARGR 504
gi 1040206987 433 SSSGSKMPFFSPRLHFLAPQPKLPEEARSLSPKPRPSAKWPSGWEWEAELLDELWTGQTRAPSRGLGTIDKEG-QdHDGW 511
gi 625268734  431 PTFGSKLPFLSPGFRFLPTKPGPPEVSSSPSPKLWPRAKWPSGWEREAEQLGELWGGRTRVPPQGQEPAADDA-SdDSGW 509
                         570       580       590       600       610       620       630
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 341940555  501 PLAAPQVLEATSQVLWKPMVISETMKLVPGVSMWNRGTQELLNPAVIRKEAEEGTPQAP--EQQPIQTGVSKP 571
gi 222831618  501 PLAAPQVLEATSQVLWKPMVISETMKLVPGVSMWNRGTQELLNPAVIRKEAEEGTPQAP--EQQPIQTGVSKP 571
gi 281343065  505 PQMAPRVLEATSQVMWKPMLLPDAMKLAPGVSMWNPSTQVLLRAAVPQQEDKESVTSLPi-EQHPIQTDAPKP 576
gi 349585094  518 PHPAPQVLEATSQVMWKPMLLPEALKLAPGVSMWNPTTQELLSSAEPQQEDKKGSTSP------PIHTGAPEP 584
gi 222831616  513 RHPVPQVLEATSQVTWKPVLLPGALKLAPGVSMWNPSTQVLLSSSEPQRNDREGSASP------PIHTGAPKP 579
gi 731493342  509 PLLAPRVLEATSQVMWKSVLLPDAMKLEPGVSLWNPSTQVLLSASEPQEEDKEGRISPPv-EQHPIQTGAPKP 580
gi 831231888  510 PRTTRQVLEATSQVLWKPMLLPEAMKLAPGVSMWNPATQVLLSSAVPQQEDKEGGTFPPi-DQHPIQTAPLKP 581
gi 562844649  505 AETPPHVLAPTSQVLWKPLLLPEAVRLTPGVSMWSPNAQVLLSSAVPPQENKDGSCSPS--EQHPIQTSAPRP 575
gi 1040206987 512 PQPA-QVLEATTQVLWKPLLQPEAVKLAPGVTLWEHGTKVLLSSAVSQEENQEDSTSPPteQQHPIQMGAPKP 583
gi 625268734  510 PLAAPQVLEATSQVLWKPMVLSETMKLVPGVSMWNRGTQELLSPDAILEEAEGGTSNGA--EQQPIQTGVSKP 580
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap