Conserved Protein Domain Family
Nbas_N

?
pfam15492: Nbas_N 
Neuroblastoma-amplified sequence, N terminal
Nbas_N is an N-terminal family of metazoan sequences. This domain lies at the N-terminal of several WD40-containing proteins. The human protein is over-expressed in neuroblastoma cells.
Statistics
?
PSSM-Id: 317843
View PSSM: pfam15492
Aligned: 4 rows
Threshold Bit Score: 567.635
Threshold Setting Gi: 1033388919
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82232910     79 WQLVLASNGKLLAVVQDQCVEIRSARDDFGSIIGKCQVPKDPNPHWRRVAWSHDCALLAYADSTGTVRVFDLMGSELFII 158
gi 1033388919   99 WHLVLSSNGKLLAAVQDQCIEIRSAKDEFGSVIGKCQVPKDPNPQWRRVAWSHDCTLLAYSESTGTVRVFDLVGSELLVI 178
gi 768940818    79 WHVVLASNGKLLAVVLDQCVEIRSVRDDFGSVIGKCQVPKDPNPQWRRVAWSHDCTLLAFADSTGTVRLFDLIGSELFVI 158
gi 752416153    90 WHLVLASNGKLLAAVQDQCVEIRSAKDDFTSIIGKCQVPKDPKPQWRRVAWSYDCTLLAYAESTGTVRVFDLMGSELFVI 169
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82232910    159 PPAMSFPGDFSYAAAGLMFLEYTGSAQWSAELLVITYSGQLKSYLVSVGTNQGFQENHTFSFSAHYSNGITTAIYHPGHR 238
gi 1033388919  179 SPGTTFPGDLTYAIAGLVFLEYKASAQWSAELLVINYRGELKSYLVSVGTNQSFQESHSFSFSSHYIHGITAVIYHPTHR 258
gi 768940818   159 PPVVSFPGDFSCAVAGLIFLEYTGSAQWSAELLVITFGGGLKSYLVSVGTNQNFQENHSFSFSSHHSHGITSAIYHPAHR 238
gi 752416153   170 TPASSLAGDLSYAIAGLIFLEYKASAQWSAELLVINYRGDLKSYLVSVGTNQSYQESHCFSFNSHYPHGINTAVYHPGHR 249
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82232910    239 LLLVGGCESG--DSDVSRASQCGITAWRVLSGLPHYKQVTSYEDDISSs-QRRGFFKMPSFRLFSRHNGEQDGVFRMSLS 315
gi 1033388919  259 LLIIGGCETDgdGAGLSKASSCGLSAWRVLSGSPYYKQVTSYEDDIGTa-KRSSLFKIMNLKFYSRQGREEDGVFKMSLS 337
gi 768940818   239 LLLVGGCESG--DDGTSKASSCGITAWRTLSGSPHYKQVTSNEEDVGl-sQKRGFLRLPSFRLFSRHADEKDGVFRMSLS 315
gi 752416153   250 LLLVGGCETA--DVGVSKASSCGLSAWRVLSGSPYYKQVTNGGDRVTAvpKTLGLLRMLSVKFYSRPGQEQDGIFKMSLS 327
                          250       260       270       280
                   ....*....|....*....|....*....|....*....|....
gi 82232910    316 PDGTILAVIHFSGSLSLWDIPSFKLRGSWKQEEQPGFDEINPEW 359
gi 1033388919  338 PDGTRLAAIHFSGKLTIWGIPSLRQQGEWEQSEQPGYDDIKPEW 381
gi 768940818   316 PDGTLLAVIHFSGRLSVWDVPSLKQRATWGQDQQPGFDEINPEW 359
gi 752416153   328 PDGTLLAAIHFSGKLSIWAIPSLKQQGEWNQNEQPGYDDLNPDW 371
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap