Conserved Protein Domain Family
DUF4647

?
pfam15504: DUF4647 
Domain of unknown function (DUF4647)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 282 and 480 amino acids in length.
Statistics
?
PSSM-Id: 317854
View PSSM: pfam15504
Aligned: 13 rows
Threshold Bit Score: 609.919
Threshold Setting Gi: 81896169
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81896169   22 MNVADESQWDEAVCTLSGCQHPQCWASLRRIERGHPRILDPSPKSPRETEDKLPTLTIVNITDTCLWTqkrvaqQQPSEF 101
gi 831218026   1 MDLPDDSQWDETTCDLALCQHPQCWATVRRIERGHPRILSSPCKTLQPDEDKLPELTIVNMSDSCFFS------RHLSKF 74
gi 755506202  22 MNVADESQWDEAVCTLSGCQHPQCWASLRRIERGHPRILDPSPKSPRETEDKLPTLTIVNITDTCLWTqkrvaqQQPSEF 101
gi 752390708   1 MDLPDESQWDETTCKLALCQHPQCWATIRRIERGHPRILAPPCKTALNDEDKLPVLTIVNMADSCIQAkgl-ahRHLSGF 79
gi 928149752   1 MHLPDESQWDETTCKLAICQHPQCWATIRRIERGHPRILGTPRKTTIDDEDKLPMLTIVNMSDSCIRAkrl-ahHHLSGF 79
gi 587008930   1 MDLPDESQWDETTCKLAVCQHPQCWATIRRVERGHPRILGPPCKTALNNDDKSPVLTIVNISDSCFRAkrl-ahGHLSGF 79
gi 940731826  20 MDLPDESQWDETTCNLAACQHPQCWATIRRIERGHPRILGSSYKTPLDVNDKLPVLTIVNLSDSCFQArrr-phGHLPGL 98
gi 927098955   1 MNLPDESQWDETTCHLAVCQHPQCWAAIRRIERGHPRILSSSCKPPLNVEERLPMLTVVNLTDSCFEAkrl-ahRHLSKF 79
gi 965919445  17 MDLPDKSQWDETTCDLAVCQHPQCWATIRRIERGHPRLLDSSSKSFVDAEDKLPVLTIVNIADSCFPAkrvirrRHLPGF 96
gi 884874026   4 MVLPDDSQWDETTCDLAVCPHPQCWAAVRRIERGHPRIRSSPCKTPVDAEDKLPGLTVVNISDSCFQArrl-ahQQSPEF 82
gi 655878746   1 MDLPDETQWDETTCNLALCQHPQCWASFRRIERGHPRILGSPCQTPVGPEDKLPMLTVVNISDSCFRAkrl-arRPLLAS 79
gi 686731253   1 MDLPDESQWDETTCGLAVCQHPQCWATIRRIERGHPRILGSSCKTPLDAEDKLPVLTVVDISDSCFAPr------HLPEC 74
gi 725561505   1 MDLPDESQWDETTCGSAVCQHPQCWATIRRIERGHPRILSSPCKTPPDAEDKLPVLTVVNIPDSCFAPr------HLPEC 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81896169  102 TFPKDRPSL---SKPASKRQSRSPKALRDKDVTSRSPRPLK-------LSVLNLNEAKLPLSENVSNMVVTWVPEET--E 169
gi 831218026  75 TFSKARSLLcrgSKSKSKFQGRPQKGLPVKSWINSTNKPSK-------LSVLNLNDTPLPCSEDVSNMVVIWVPEES--E 145
gi 755506202 102 TFPKDRPSL---SKPASKRQSRSPKALRDKDVTSRSPRPLK-------LSVLNLNEAKLPLSENVSNMVVTWVPEET--E 169
gi 752390708  80 TFTKPSSSLcpgSKFDSKFQGRPRKDLPDKDLIDRTDRSPKvnhrlekLSVLNLNETQLPSPQDVRNMVVIWIPEQS--E 157
gi 928149752  80 TFTKPPSLLcpgSKVHSKFQGRPQKDLPNKDVIGNTDRSPKvnhrltkLSVLNLNETQLPSPQDVRNMVVIWIPEQP--E 157
gi 587008930  80 TFTKAPSLLcqgSKFDSKFQGRPRKDLPDKDFTRYTDNSPK-------LSVLNLNETRLPSSQDVRNMVVVWIPEQP--E 150
gi 940731826  99 TFTKPHSLLsqrSKFDSKFQGRPRKDLPDKDLIIYTNRSPKgshklekLPVLNLNETQIPHPQGVSNMVVVWIPKEP--G 176
gi 927098955  80 AFTKARPLLsqgSKFDLKFQGRPLKDLSDKDFINRTDRPPK-------LSVLNLNETRLPCLQGFRNMDVIWIPEEP--E 150
gi 965919445  97 TFTKAHSLLs--SKFDSKFQGRPWKDLPDRDLMNRTDRSPK-------LSVLNLNETKLPCPQDVGNMDVIWIPE----- 162
gi 884874026  83 AFTKAHSLLsqgSKLASKFQGRTQKGLPEKNLINYPKRFPKesh--kkLSVLNLNETQLPCSEDVRNMVVIWIPEELgkN 160
gi 655878746  80 AVSKAHALLsreSKFDSKFQDRPQKGLPD-DLSSLTERAPK-------LSVLNLNEIEIPSSKDVRNMVVVWIPEEQ--E 149
gi 686731253  75 TFTKAHSLLsrsSKFYSKFHGRPPKGLPDKSLIHCTNRLPK-------LPVLNLNETQLPCPEDVRNMVVLWIPEET--E 145
gi 725561505  75 TFTKTRTLLsqsSKFYSKFQGRPPRGLPDKSLISCANRLLK-------LPVLNLNETQLPCPE--RNMVVLWIPEET--E 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81896169  170 KDvspvqktdvssw-pgkkrrkklrkKSKPSLYYPGRQYS------RSPAAIVPPPSPEHHLEQLSPEAIPLWAQVGM-- 240
gi 831218026 146 KS------------------------KKGSSPSFSRKQYPet--qsRMLKMIVPPPTPVPLSEQLASDCIPSWDPFHV-- 197
gi 755506202 170 KDvspvqktdvssw-pgkkrrkklrkKSKPSLYYPGRQYs------RSPAAIVPPPSPEHHLEQLSPEAIPLWAQVGM-- 240
gi 752390708 158 THvspaekkhilpsqnrmkrrmkstvKd---rFLNGKQKTet--llGPPGVVVPPPSPAHFIEQLNAEsIPFWNQLDM-- 230
gi 928149752 158 KQmspaekkhvvpsqdwrkgrmkstvKDSFLNEK---QKTet--qlGPPEMIVPPPSPVNFFEQLSTEsIPFWNQFDM-- 230
gi 587008930 151 KRarpaekkrivs---sqdgrmncvaKDHFLY---RRQKTea--qlGPPRMHVPPPLPVHIFEQLTSEsIPFWNQFDLep 222
gi 940731826 177 ASvspaeqyvapsq---dgkkkrktstvSSVV-LSGKQDRet--klSTPGMLVPPPSPVRFFEQLSPEfLPFLNQFDT-- 248
gi 927098955 151 KQvspaekkhivcs------------qngkmerkksagKDrssrvhTGTGVTVLPSSPVHLLEQLSLEsVPFWNHCDM-- 216
gi 965919445 163 KHvspaeekhlicsqdgnmnrkkspgKHKSEL----------------PGIIVPPPTPAHLYEQLSSEsLPLWNQFDM-- 224
gi 884874026 161 VYlpektsplpsq---------------ngkqkrkesarKte--ssKTPGKAVPPPSPVRASEDLSSE-MPIWAHNST-- 220
gi 655878746 150 KPvsqhekk----------krkkstvKNKLSLGLPGKQHTra--qlRAPAITVPPASPVHLYEQFSSEsMPVWAPVDM-- 215
gi 686731253 146 IHvsqhgkk----------krknsavKSKSFLGLSGNQSAet--rvGTPGMIVPPPTPVQLSEQFSSDfLPLWAQSEA-- 211
gi 725561505 144 IDvshhgkk-----------kknlavKSKSFLGLSGNQSTes--rvGTPEMIVPPPTPVQLSENFRSDfLPLWAQSEA-- 208
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81896169  241 LPQDLLEECILAHEKSIIGPEVKIELSKMRKSLPLERRRPESAISSKMYLTIQRLTLQRPSLRYPARLRKLCPNLKqGE- 319
gi 831218026 198 LPQDLLEELLSDEGKTMLSPEMKIQLAMMKKSLPLEKNRPDSAISSKMFLSVHRLTLQRPALRYPEFSKKLRCNLK-TE- 275
gi 755506202 241 LPQDLLEECILAHEKSIIGPEVKIELSKMRKSLPLERRRPESAISSKMYLTIQRLTLQRPSLRYPARLRKLCPNLKqGE- 319
gi 752390708 231 LPQDLLKDLLPGEGKTMPSLEMKTQLAMMKKKAPLERSRPDSAISARMFLSVHRLTLQRPALRYPKHLKNFYYNPN-TE- 308
gi 928149752 231 VPQDLLKDLLPNEGKTMPSLEMKTQLAMMKKKPPLEKSRPDSAISAKMFLSVHRLTLQRPALRYPKHLNKFYYNLN-TE- 308
gi 587008930 223 LPQDLLKNLLPDEGKTRPSLEMKTQLAMMKKKVALEKSRPDSAISAKMFLSVHRLALQRPALRYPEHLKKLCSNLN-TE- 300
gi 940731826 249 LPQDLLNDLLLDEGKRSPCLETKTQLATRKKN-PLKKSRPESAISAQMFLSVHRLTLQRPSLKYPAHLKKLYYNLN-IEd 326
gi 927098955 217 LPQDLLQDLLLDKGKTIPFPEMKTQLTVMKKKPPLEKSRPDSAISAKMYLSVHRLTLQRPALRYPEHLRKLYNNLT-TE- 294
gi 965919445 225 LPQDLLKDLLLDKGKTILYPEIRTQLAMMRKKPPLEKSRPDSAISAKMYLSVHRLTLQKPALRYPEHLKKHCSNLK-TD- 302
gi 884874026 221 LPQNLLKELLPHGENNMPCPEMKIQLDRMKKSLPLEKNRPDSAISSKMFLTIHRLTLQRPTLQYPEHRKKLHSTLK-RE- 298
gi 655878746 216 LPLDLVADLFPGGGRDMPCPELKIQLAMVKKTLPLEKDRPDSALSSKMFLTTHRLTLQRPSLRYPEHWKKLQYSLK-IE- 293
gi 686731253 212 LPQDLLKELLPGGKQTMLCPEMKIKLAMMKKNLPLEKNRPDSAISSKMFLSIHRLTLESPALRYPERLKKLH-NLK-TE- 288
gi 725561505 209 LPQDLLKELFPGRKQTMPCPEMKIQLAMMRKNLPLKMNRPDSAISSKMFLSIHRLTLERPALRYPERLKKLH-NLK-TE- 285
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81896169  320 ---------G----------LAGHGSSd-------------SL-MQQGKAKTFPPK---QEPKKKAKRNVKGQYGEETTS 363
gi 831218026 276 ---------D----------GFAGRQQ--------------EQ-QQQQQRRVQTPT---KEAKNKARNGPGIQGTSNKRL 318
gi 755506202 320 ---------G----------LAGHGSS--------------DSlMQQGKAKTFPPK---QEPKKKAKRNVKGQYGEETTS 363
gi 752390708 309 ---------G----------HKKQQQWq-------------QK-QQQRKVKTPPKR---QEDKKKSKSDLGSQDILHKRL 352
gi 928149752 309 ---------G----------HKK-QQWq-------------QK-QLQQKLKTPPRR---QEAKKKPKSDPGSQDILHKCS 351
gi 587008930 301 ---------GrfsgavrssgHKQQQQQqqq---------kqQQ-QQQRLVKTPPKR---QEAKKKPKSDPGSPNILHKRS 358
gi 940731826 327 rlssaarspG----------LRKQq----------------QK-QQQRKLKTPMKEpkkPEAKKKSKKDPGSQSTSRKSL 379
gi 927098955 295 ---------G----------GRKq-----------------QR-PQQKRVKTPSRK---QEATKKSRSAAGSHKTSPKHS 334
gi 965919445 303 ---------G----------HRKq-----------------QR-QQQRKVKTAARK---QEAKKRCRSEPESHNSSRKHP 342
gi 884874026 299 ---------D----------YRKQQQW--------------QQ-LQEKKEKNPPKE---QKAKKKAKSEQGIQNTSQKHS 341
gi 655878746 294 ---------G----------LRKQQWW---------------Q-QQQRK-----------GAKKKAKGDAKRWDMSRQHS 327
gi 686731253 289 ---------G----------YRKQQQWqqrqqqwqqrqqqqQQ-QQQRKVKTPIKK---QEAKKKAKSDPGSQSTSHKHP 345
gi 725561505 286 ---------G----------YGKQQQWq------------rRH-QQQRRVKTPTKK---QEAKVKAKGDPGSQSTSRKHP 330
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81896169  364 GHFFH----DSVGL------RISGQEd-QQTPWEEEdiekTSAETHVSLEEVyEFD--KYYTEYYAT---PESAVLyETV 427
gi 831218026 319 STIAYdplfGLRTLr----gQKSHMK--QQQRWLTL----SRLVEMNSTERS-KMDysKKCVDFSLSmesLGSPER-ELT 386
gi 755506202 364 GHFFHd----sVGL------RISGQEd-QQTPWEEEdiekTSAETHVSLEEV--YEfdKYYTEYYATpesAVLY---ETV 427
gi 752390708 353 GAVVYgpryGQRTLl----sRKSDKK--QPQQVKPE----GPTSIKCSTRRP-RMEysENYLDSFPDkddPELSKT-EPS 420
gi 928149752 352 GAVAYgpryGHRTLl----gRKSDKK--QPQRMKSE----GPTSRQDSKRRP-QVEysENYPDSFPDkddPELSKT-EPS 419
gi 587008930 359 GAMVYgprhAHRTLl----gWKSDQK--QPQWMKLE----GLTLKQDSTERP-QM---KNYLDSFPSkddPELSKT-KPS 423
gi 940731826 380 ---------GHRTLp----gGESDNN--QQLQMEKN----GPILKQDSTERP-QMGnaENDLDSFSSkqnPELSKT-EST 438
gi 927098955 335 GAVVYdphcGHRTLp----hQEGDKK--QQQQTETE----GPAVKQDATKRP-QMAssQKCLDSFPSkksAELLKI-ECT 402
gi 965919445 343 ---------GRKTLr----gQQSDKKr-QQQQMKTR----GPPSKQDSTERP-QTNiaEKFLDSSRSkksPELSQI-EYT 402
gi 884874026 342 AAVACnplcGIELTtsclpgQESDMKq-QQQQMKTE----GATLEPVSIESS-RNDhsDKFLGIFPDrrgSKMSMM-ELP 414
gi 655878746 328 VNIVCdsvcE-----------SDGML--QEEg--------------------------------------PELSEL-EPA 355
gi 686731253 346 VTTIHgplyGYRTLp----gQNSDMK--QQQQMEK-----GTTLKQDSTERP-KMNy-YDHADFHHSvksPELYET-EPT 411
gi 725561505 331 VTTVHdrlyDYRTLp----gRNSDMKqrQLMETEE-----TTS-KQDSTERP-KMDy-YDHVDLYHRvksPELYET-EPT 397
                        490       500       510       520       530
                 ....*....|....*....|....*....|....*....|....*....|..
gi 81896169  428 YQNLDDDEETMVG----IkassKDRNLKNlsammdgiGWNPELKLLRILQAT 475
gi 831218026 387 NKNISAPVKATLE----P----QASRSED--------SWNPELKLLRILQAT 422
gi 755506202 428 YQNLDDDEETMVGikasS----KDRNLKNlsammdgiGWNPELKLLRILQAT 475
gi 752390708 421 NKDIGAQE---------S----QDRSSEDlsddssgrRWNPELKLLRILQAT 459
gi 928149752 420 KKDISAQKAVVLA----S----QGRSPEDlsdstsrrRWSPELKLLRILQAT 463
gi 587008930 424 NKDISTQEDAVLE----S----QERSPEDlsdgtsrtRWNPELKLLRILQAT 467
gi 940731826 439 NKDFGPQMEEVPV----A----HEEPSKDlsssisraSWNPELQVMRISQAA 482
gi 927098955 403 SKDVRTQVEVLLE----A----SKRTPNSas----riGWHPELKLLRILQAT 442
gi 965919445 403 KKDIKTQMEILLE----D----RMRTPKSas----svSWNPELKLLRILQAT 442
gi 884874026 415 CKDVNASVEMVLE----ApaanQEKIPEDltenvaeiSWKPELQLLRILQDT 462
gi 655878746 356 YENNSTAAEAVLE----A----RRETSKRlagsvtgvSWNPELKLLRIIQAT 399
gi 686731253 412 NKDISAPVEAVPE----AqaarRKKISFNfseimartGWNSELKLLRILQDT 459
gi 725561505 398 NKDISALVEAVSE----AqavsQKKVSLSfsesmartSWNSELKLLRILQDT 445
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap