Conserved Protein Domain Family
CENP-T_C

?
pfam15511: CENP-T_C 
Centromere kinetochore component CENP-T histone fold
CENP-T is a family of vertebral kinetochore proteins that associates directly with CENP-W. The N-terminus of CENP-T proteins interacts directly with the Ndc80 complex in the outer kinetochore. Importantly, the CENP-T-W complex does not directly associate with CENP-A, but with histone H3 in the centromere region. CENP-T and -W form a hetero-tetramer with CENP-S and -X and bind to a ~100 bp region of nucleosome-free DNA forming a nucleosome-like structure. The DNA-CENP-T-W-S-X complex is likely to be associated with histone H3-containing nucleosomes rather than with CENP-nucleosomes. This domain is the C-terminal histone fold domain of CENP-T, which associates with chromatin.
Statistics
?
PSSM-Id: 317860
View PSSM: pfam15511
Aligned: 11 rows
Threshold Bit Score: 142.565
Threshold Setting Gi: 213405899
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74673905  372 HGIPVPN-MPVGVVRKLATRFARARAgSKTKISKATLAAIEQASAWYFEQVSEDLAAYSKHA-GRKTIDETDVTTLLRR- 448
gi 121932647 380 YGIEYPS-LPPAVVKRLAQNFAKAGG-IKGKITPDAMKSIMQASDWFFEQMSEDLQAYAKHA-GRKTIDESDVLTLMKR- 455
gi 81909300  407 RHHQDPY---KAGLSHYVKLFSFH---TKMPVEKAALEMVEKCLDEYFQRLCNDLEVFAAHA-GRKTVKPKDLELLMRR- 478
gi 213405899 365 RTHANDCfLPTIAIRKLAHRFS------SRKLSASAMDHLVSISNKFMSQMLHDLETYADHA-SRKTINSEDVILLLKR- 436
gi 389646785 443 YGHSCPS-LPAPVVKRLAETIARTSGiGNAKITPETLQALMQSTEWFFEQMGDDLRALAHHA-GRKTIEQSDVITLMKR- 519
gi 927137786 349 RPRPDPY---KAGLNHYAKLFSFY---AKMPMERKAVEMVEECLDKYFQHLCGDLEAFAAHA-GRKTVRPEDVELLMRR- 420
gi 345317037 643 RPPRTPG---SALLSHYAKIFGFY---AKMPVEKAAYKVVEKSLDRYFRQLGDDLEVFTSHA-GRKTVEAEDLELLMRR- 714
gi 169595190 384 RGLEYPS-FPAASVKKLALGFMKSQG-SKGQLNKESLNALVKVTDDFFEQIGIDLAAYAQHG-GRKMIEESDVIALMKSs 460
gi 930135010 440 HGIEYPS-LPVGVVKRIGQMFAQGSAaGKTKLSPDTVAALTTASDWFFEQVGVDLERYSKHA-GRKTIDESDMLLLMKR- 516
gi 684161863 377 HGEMVPS-LPTSLIKRVAIDASSRLGiRKPRLGREHMQALEQATEWFFEQVGDDLAAYSDHArRRKRVDRSDALMLMRR- 454
gi 242813366 360 HGIPVPL-LPTGVVKRLAARFARTGAgTKAKINKETLAAIEQASEWFFEQASEDLAAYSKHA-GRKTIDESDVVALMRR- 436
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 74673905  449 ---------QRHINNTTTVFSLAQKYLPKELLQDMRLAMPP 480
gi 121932647 456 ---------QRQINPNTTPFALAQRNLPRELLQELRMPPPV 487
gi 81909300  479 ---------QGLVTDQVSLHVLVERYLPLEYRQQLIPCAFR 510
gi 213405899 437 ---------QRKITKKTSLEALALQYLPRELVASVTQGKQK 468
gi 389646785 520 ---------QRQIDSQATLFSLAQRHLPRELLQVLRMPARA 551
gi 927137786 421 ---------QGLVTDQVSLHVLVERHLPLEYRQLLIPCAFS 452
gi 345317037 715 ---------QGLVTDDVSLHVLVERHLPMEYRRLLIPCATS 746
gi 169595190 461 rimlmlfyrTRKTTSNNTIFSLAQKMLPRELLQQLRMEPPQ 501
gi 930135010 517 ---------QRQVSATTTPFSLAQRYMPRELLQELRMIPEA 548
gi 684161863 455 ---------QRVLQGDGELRKAVRELLPKEAAAELEEMMRG 486
gi 242813366 437 ---------QRLVNSTNTIFSLAQRHLPKELLQDIRLSLPP 468
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap