Conserved Protein Domain Family
CAF1-p150_C2

?
pfam15539: CAF1-p150_C2 
CAF1 complex subunit p150, region binding to CAF1-p60 at C-term
CAF1-p150_C2 is part of the binding region of the CAF1 complex p150 subunit to the p60 subunit. The CAF1 complex is essential in human cells for the de novo deposition of histones H3 and H4 at the DNA replication fork.
Statistics
?
PSSM-Id: 317878
View PSSM: pfam15539
Aligned: 6 rows
Threshold Bit Score: 360.014
Threshold Setting Gi: 597742502
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229462842 665 AKEWDEFLAKGKRFRVLQPVKIGCVWAADRDcAGDDLKVLQQFAACFLETLPAQEEQTPK---ASKRERRDEQILAQLLP 741
gi 355703001 648 AKEWDEFLAKGKRFRVLQPVKIGCVWAADRDcAGDDLKVLQQFAACFLETVPVQEEQTPKaskASKRENRDQQILAQLLP 727
gi 755694657 650 AKEWDEFLAKGKRFRVLQPVKIGCVWAADKD-GGADLKVLQQFTACLLETVPSEEEQTPK---ASKREKRDQQILAQLLP 725
gi 395831689 659 AQEWDEFLAKGKRFRVLQPVKIGCVWAADGDcVGADLKVLQQFTACLLEPVPAEEEQTPT---ASKKEKRDQQILAQLLP 735
gi 597742502 600 AREWDELMTK-KKLKVLEAVVKGCIWEEDEP----SVEFLKPFAVCMLEPLPRDEPSTPEn--DAVRKQKKEQLLSLLLP 672
gi 513008747 658 AKEWDEFMAKGKRVRVLQPVQIGCVWADDTGcSTADLKVLQQFTAWRLESAPSEDKLVPK---ATKREKRDQQILAQLLP 734
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229462842 742 LLHGNVNGSKVIIREFQEHCRRGLLSNHTGS-------PRSPSTTYLHTPTpsEDAAIPSKSRLKRLISENSVYEKRPDF 814
gi 355703001 728 LLHGNVNGSKVIIREFQEHCRRGLLSKHTGS-------PPSPSATCLHTTS--EDAAIPSKSRLKRLISENSVYEKRPDF 798
gi 755694657 726 LLHGNVNGSKVIIREFQECCRRGLLGKDTGSpdsssasPPSPGSSRPQTPTssEDAAVPSKARLKRIISENSVYEKRPDF 805
gi 395831689 736 LLHGNVNGSKAIIREFQEHCRRGLLTGGASS-------PPSPASSCPQTPT--VDTAIPSKALLKRIISENSVYEKRPDF 806
gi 597742502 673 LLHGNVNSSKVIISEFQEFCRQQM---------------ASPSGSPQNVDN------IPPRIHVKRLMKENAVYEKRSTY 731
gi 513008747 735 LLHGNVNGSKAIIREFQEHCRRGLLSVGGASs------PPSPTTPRPHTPT--EDTAVPSKARLKRIISENSVYEKRPDF 806
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 229462842 815 -RMCWYVHP-QVLQSFQQEHLP-VPCQWSYVTSVPSA---PKED--------SGSVPSTGPSQGTPISLKRKSAGSMCIT 880
gi 355703001 799 -RMCWYVHPqQCSRAFTNQPSPgNPCWWLYVRDWCNP---PASA--------SQSTGITDLSQGPQGSLVVASRINLTFG 866
gi 755694657 806 -RMCWYVHP-QVLKSFDQEHLP-VPCQWSYVTVVPSA---TRED--------SGSIPAAGPGQGTPMSLKRKSAGSMCIT 871
gi 395831689 807 -RMCWYVHP-RVLRSFDQEHLP-VPCQWSYVTMVPSAprePRED--------SGGISTTGPSQGIPISLKRKSAGSMCIT 875
gi 597742502 732 rRCCWYVHA-EVLARFGQEALS-VPCKWSYLTSGAHV---TRDEptgqlpgsQNTSPSAPQSSSTTPSNRRKSASNHSIT 806
gi 513008747 807 -RMCWYVHP-QVLHSFNQEHLP-VPCQWSYVTMVPSA---PRED--------SGSVPATLPGQGTPVSVKRKSAGSMCIT 872
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 229462842 881 QFMKKRRHDGQIGAEDMDGFQADTEEEEEE---EGDCMIVDVPDAAEVQAPCGA-ASGAGGGVGVDTGKATLTSSPLG 954
gi 355703001 867 QFVTKLGSGCWVGAEDMDGFQADTEEEEEE---EGECMIVDVPDAAEVQAPCGA-TSGAGGGVGVDTGKAALPASPLG 940
gi 755694657 872 QFMKKRRHDGQVGAGDLDGFQADTEEEEEE---DGDCVILDISDVGEAQAPCGT-ASGAGGSVGMDSSESPPPASSLG 945
gi 395831689 876 QFMKKRRHDGQVGAEDMDGFQADTEEEEEEedgDGDCVLMDALDAGEVQAPCGT-TSRTGVALGMDTSKSPLPSSPLT 952
gi 597742502 807 KYMKKCTDPEQTDAMETDGFQADTEDDEDE-----DCVIL-CEQSGSSEQDCQTsTTEAKTTEPVDISDTALslpcpt 878
gi 513008747 873 QFMKKRRHDGQIGVGDMDGFQGDTEEEEEE---DGDCMIMEIPGIGEAQDPCGT-TSGAEGAVGMDTSEGPLPTSPLG 946
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap