Conserved Protein Domain Family
DUF4657

?
pfam15552: DUF4657 
Domain of unknown function (DUF4657)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 305 and 370 amino acids in length.
Statistics
?
PSSM-Id: 317886
View PSSM: pfam15552
Aligned: 20 rows
Threshold Bit Score: 365.29
Threshold Setting Gi: 611981610
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286070  78 MVVGDSSLATLSGLSQDSLNLEPMGSPE-------LPPAQLDRLLARQKLEEVLERSR----------EFP----SLSAQ 136
gi 611981606  73 MGGGESPSTAPSSLALDSSNLALGGRPKmas-vtmEPPPDLDRFLASRKLEQVVARSC----------WPRsspaTLPKC 141
gi 426359064 146 MAVGDSPLAALPGLSQDSLDFESSGSP--------EPPAQVGRLLASQKLGEVLERSR----------RLPtvptSLSGQ 207
gi 831232852   1 MAVGDSLLATLPGLSQDSLDFEPLGSP--------ELPTQQGRFLASHKLEQMLERSH----------RLPtgpaSLSGR 62
gi 344281321  78 MAIGDSSLATLPGISQDSLDFEPSGRS--------EPPPQLGRLLASRKLEQVLERSH----------RLPtspaSLSRQ 139
gi 655890018  78 MAVGDSPLATLPASSQDSLDLEPAGSA--------EPPARRGRTLASQKLQQVLERSR----------RLPpppaDLAGQ 139
gi 351703101 207 MVAGDSTLATFPGLSQDSVSVEPMRSPEptalaapEPPSQLGQLLASRKLEQVLEWSQggahpstqhcALPpapwT---- 282
gi 884944686  86 MVAGDSPVATFPGLSQDSLSVEPTGSCEpsalaapEPPGQLGRLLASRKLEQVLERSQarprlsaqchALPsapwS---- 161
gi 532087317  77 MVVGDSPLATLSELSQDSLNLEPMGSPEhlaldatEPPAQLGRLLANHKLEQVLERSR----------QLP----SVSGD 142
gi 625183204  69 MVVGDSPLATLSGLSQDSLNLEPTGSPE-------LPSVQLDRLRARRKLDQVLERSQ----------EFP----SLSGQ 127
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286070 137 -RGPlqllNKPVDGVPIF-AGEQESTEADTELEAGLEEAKEVgNMESAACTCLPGQGLRYLEHLCLVLEQMVRLQQLYLQ 214
gi 611981606 142 -WQQ----REQGSEVSSEvTRDQNGTKAEPGSQAGPAESLAL-GSEADAWACLPGQGLRYLEHLCLMLERMAMLQQLQQQ 215
gi 426359064 208 -RHSlrlaTKPEREVPLFgAGEKESMEADTDLEAGLEE-EAVgGLGPGAWACLPGQGLRYLEHLCLVLEQMARLQQLYLQ 285
gi 831232852  63 -RSPfqppSKPECEVPLYgAGKQESSEVHVDGEASLEATEVe-GPGPEAWTCLPGQGLRYLEHLCLVLEQMARLQQLYLQ 140
gi 344281321 140 -HRPlqlpSKPECEMFPFaAGEQEATEAETGLEAGLEEAK-VgGLEPEVWTSLPGQGLRYLEHLCLVLEQMARLQQLYLQ 217
gi 655890018 140 -RDSpqppGKPECGVYLFeATEQECTGAETDPEAGLEE-EVVaQLEPGTWACLPGQGLRYLEHLCLVLEQLARLQQLYLQ 217
gi 351703101 283 ---------RPGCAPPLLg--------AEAKLEQDLEEAEVVaAVVPRAWACLPGQGLRYLEHLCLVLEQMARLQQLYLQ 345
gi 884944686 162 ---------RPGCEIPLLgAG-QEPTKAKAEPEVDLEEAEg-vTVVPRAWACLPGQGLRYLEHLCLVLEQMARLQQLYLQ 230
gi 532087317 143 -HGSl---SKPKCGVSLFgAGEQETTEAETKLEAGLE-AEVVqGVDPGSWACLPGQGLRYLEHLCLVLEQMARLQQLYLQ 217
gi 625183204 128 rRHSlqllSKPVGGVPIF-AGELESTEAATE----LEEAKVVgDVESGALTCLPGQGLRYLEHLCLVLEQMARLQQLYLQ 202
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286070 215 LQTQRPSRDP----EEE---VLAPALSSSHIpdnrVQEHREELSQTKDP------EGAEAASLPEVGVLVTSPSRLPEAL 281
gi 611981606 216 LQQQHQQMPTgtegTNEs-sILAPYRPRVSS----VLGPQEFQRLVEKTg-----KVEESVLPRQAQMHSVSTPSLLEGP 285
gi 426359064 286 LRIQRPPGDP----GKEe-sTRAPLPSPLYTpgngGQgpwELLSQTEQ-------TGAKAASPPKVEVPSANPPRLSETP 353
gi 831232852 141 LQSQRPPGDP----EEEe-lAVAPSPSPSQTssnqVQrpwELRSQTEE-------SGTKAASPPKVGMPNTSHPKLAEAP 208
gi 344281321 218 LQTQRPLRDP----EEEeesALAPSPSPSHApgneMRvpcDLLRLTKET-------GAKAASFPKVGVPSGNSSNLPEAP 286
gi 655890018 218 LWSQRLPGDP----EGEe-sALAPAPLSSDSlgsgVQgpwELLHQTRQA------EGAEAALPPKVWVPTANPPRLPEAP 286
gi 351703101 346 LRTQSPPEDP----EEEe-lALAPLPSLLPApgsgVQgseELQSLTKE-------TGLEAASCSKVGMLSANPPRLPEAP 413
gi 884944686 231 LQTQRPPEDP----EEEe-pALVPLPSLSPApgngIKgseELLSPTKE-------TGTEAAG-SKVGMLGVNPPRLPEAP 297
gi 532087317 218 LQTQRPLGSL----EEEe-sALVPLPSPSPTpvngVQgtgELLSRTKET-------GADAALSQKVGVLSINPPRLTEAP 285
gi 625183204 203 LQTQRPSRDP----QEEe-lALALS-SSSHSpdnrMQghkEQLSQTRDLgdvvlsEGAEAASLPEVGVLIANAPRLPEAL 276
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146286070 282 LEPTHILPPSQEPK-DLSHWDKVKVLLNRLRWRSPRLPEPPVPPDGSGSRMEFRN-LSDRTPCHSQRKTFIPALVVKKPR 359
gi 611981606 286 AGAAHTIPSYQGHRnNLSHWDKVKALLNRIRWRSPRASEPSFAQDPPAPRRDSKE-LPEGPLPCSSRRTFLPSLVSKKHR 364
gi 426359064 354 VEPTYHLPSSQGHKrDISHWDKVKVLLNRICRRSHHHPEPPAPPDGSDPRIESRD-LPERPQCRPHRKTFMPSLVVKKQR 432
gi 831232852 209 VEPTHNFPCSQGHK-DVSHWDKVKVLLNRIRWRSHQQPEPPAPPGSSGLWIEPRNhLPDRPQSCIHRKTFMPSLVVKKQR 287
gi 344281321 287 AEPTHTGPSSQGHKlDLSHWDKVKVVLNRIPWRSFQHPKRSAPPNGPAPRIESRD-LSERPQCCPHRKTFMPFLVVKKQR 365
gi 655890018 287 VEPANS-PSSQGHKrDISHWDKVKVLLNRLRWRNPRHPEPLALPGGSGSRTGSRD-LPEGPQYHPHRNTYMPSSVAKKQR 364
gi 351703101 414 VEPTDSFPPSQGHKqAPSHWDRVKVLLNRIRRRSPGHPKSLVPPDGSGPRIESRD-LSESPQCHPQQNAFRPSLVVKKQ- 491
gi 884944686 298 AEPNDSFSPSQGHK-DPSHWDKLKVMLNRIRWRSPGHLEPSVPPSGCDPRTESRD-LSESPQCHHHQKTFMPSLVVKKQR 375
gi 532087317 286 VEPTHSFLLSQEHKqDLSHWDKVKVLLNRIRWRSSQHPEPPAPPNGSDPRIETRD-LSERPQYHPHRKTFMPSLMVKKRR 364
gi 625183204 277 LESTHTLPSSQGHKqDVSHWDKVKVLLNRIRWRSPRLPEPPAPPDGSGPRMEFTN-LSERIQYHSHRKTFMPTLVVKKPR 355

                 ....*.
gi 146286070 360 AKNLSV 365
gi 611981606 365 AKNFSV 370
gi 426359064 433 AKNLSV 438
gi 831232852 288 AKNLSV 293
gi 344281321 366 AKNLSa 371
gi 655890018 365 AKNLSV 370
gi 351703101     ------
gi 884944686 376 AKDLSV 381
gi 532087317 365 GKNLSV 370
gi 625183204 356 AKNLSV 361
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap