Conserved Protein Domain Family
DUF4659

?
pfam15558: DUF4659 
Domain of unknown function (DUF4659)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 427 and 674 amino acids in length. There are two completely conserved residues (D and I) that may be functionally important.
Statistics
?
PSSM-Id: 317892
View PSSM: pfam15558
Aligned: 32 rows
Threshold Bit Score: 198.677
Threshold Setting Gi: 0
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
14_pfamImport   1 EISSRDQKILALVLSRLKKAQKMRELQQQAAVAWEELKRSDKKVHMTLERERRLLLQQSQEQWQGQKEQHKSRRdheqlr 80
3_pfamImport    1 GVPDRDRKIAALMLARHQEERLLLEQRAAAHGQWEQQRVRAEQRREREEREKQRALEQGRRAWAAQVEERRGRR------ 74
8_pfamImport    1 GLPERDRKIAALMLARHQEEELLREQQALAHGQWELQRTEAMKQREKEEKEKQRALMKCHQVWVAQVEDRLDKL------ 74
29_pfamImport   1 EVSDRDRKIAALMIAKHQEESLWKEQRYSAHLQWDVQRRVAEQRREREEREKQQALLQGRRMWETRLEKRRGRL------ 74
27_pfamImport   1 YLPTRDRKILELMVSRHENQLHEREVKEFVHKRWEEEKRINELKAAEEEEARKRQLIKENEHFQAWRKMKQAAI------ 74
gi 557023125  266 EVPERDRKIAALMLAKHQEENILSEQRHMAYLQWDSERKRNELRKEREEREKQRALLQCHKMWESRVEKRRWKM------ 339
gi 449504359  223 EVPERDKKIAALMIAKHQEASLLREQRQAAHLQWDSQRRLAEQRKEREEKEKQRALLQGQRMWESQVEKRRGRL------ 296
gi 512862172  318 ELPQRDKKIAAIMIAKHQEENIRKEQRYLAHIQWDIQRKNSELRKEQEEKERQKALLHGQRSWERHMKSRENRN------ 391
gi 545507851  331 GVPDRDRKIAALMLARHQEERLLLEQRAAAHGQWEQQRVRAEQRREREEREKQRALEQGRRAWAAQVEERRGRR------ 404
gi 196002631  227 GVPEKDRKIIELMLNRHREEEESDRVRRLANLNWEQQRLALDEKMAMNLNRKKEEIRESNRARLAAQEQQKAKV------ 300
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
14_pfamImport  81 qGYEQQg-ERRDRQEKSTIqaqaESQSRWPEQPDNPENGDLDKLDRVHAQAEHLKQCQMQRLQEQERVLQSLRDLNRLQM 159
3_pfamImport   75 -GREER--EEARRRQRQCE----RSEERRRELAERQGLLRRERVERAAREDRLRKLQQEQNLKQREEGLQEGRERAELAR 147
8_pfamImport   75 -DREER--RAARRLRRRFA----QGEEQRLEHVERQSQLRLERAQRVALEDKMRKLQQEHNLKLWEEGRQKERERVSHAR 147
29_pfamImport  75 -THTWE--EAVQMKQRQTL----VEDEKWREHLEKQERLKRERLEKAALEDKKRKRHQEHNLKAQEANKKEVQVREVQLL 147
27_pfamImport  75 ---EQRiqQELAEREIAIM----MKAEKWSQLADEQEMLRRELIDRR-----KKKILRRKGRRYQRAQLSIILNQLR--- 139
gi 557023125  340 -TQEKR--DTASFKQQQTM----TQEEKWREQAEKQERARKEKLEKARQEEQQKKLHQEQNLKIKEEEKKVTLEQEGQML 412
gi 449504359  297 -NQEQE--EAALMRQKQLL----VCEERWREQAEKQERLRRERLERAIKEDKQKKLHQELNLKAKEEVKKEHQEREEQLL 369
gi 512862172  392 -SVGEM--STASLTQSKSP----LLEEKGKDQVQELEKIKGEKLANTQTVKQK-------------KSKEEKKEQEGGLF 451
gi 545507851  405 -GREER--EEARRRQRQCE----RSEERRRELAERQGLLRRERVERAAREDRLRKLQQEQNLKQREEGLQEGRERAELAR 477
gi 196002631  301 -DYENE--VQRKFKIEKIQ----EKDAKLAAITSAKQKLLEQQIQLKILQDQSKKKNQEYNLKVEEEYRNAKAIQNHLRN 373
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
14_pfamImport 160 QKKLEVTCHKRQQHlPEESQKKVPENNLsSSIINFQARKVLMDCQAKAEELLRKLSLEQSSQSSQDVQEDLAKERHREQQ 239
3_pfamImport  148 RERAQRAARTKQRQ-EGQLQREKRELSR-AERARHEALLQGRARQERAEREGLRSSLEASLGRAQENYEQLVEQRARELR 225
8_pfamImport  148 RERAERAAPTKRRQ-DIYILREKQHLSR-AERVHHEALLLVLVRKERKENEGL-MSLEAYLGRAQENYELMLAQRSRHAR 224
29_pfamImport 148 QEKLTLAAQKKLVK-EQLIQKEKKLLNQ-ADKQKHEAILKGLAKQEAEERAVLRAAMEGSLSKAQENYEQLIEKRNQELR 225
27_pfamImport 140 EHSLLKASQRRHLM-KLQRQLEVKLENE-SSVKRHVYNKLEVDEKLRSELEEMQLLTESKEARARRNYEDMVQRRAEVCQ 217
gi 557023125  413 QEKLTSAEQKKLER-ELQQQQERKSLSK-ADQLKHQALLKELAKQTQMEKKMLRKSLEQNLSKAQENYEQLVEKRNQELK 490
gi 449504359  370 QEKLSTAAQKRLKK-EVQLQKEKRLFNQ-AEKLKHEALLKELAKQEAEEKEMLKASLKMSLTKAQENYEQLVEKRNQELR 447
gi 512862172  452 QDKLLVAQHKKKEN-EEQLHISKSLQNK-AEKMKHQAMAQELTQKKEYETEELRKTLQKNLQKAQENVEQLLEKRNQELK 529
gi 545507851  478 RERAQRAARTKQRQ-EGQLQREKRELSR-AERARHEALLQGRARQERAEREGLRSSLEASLGRAQENYEQLVEQRARELR 555
gi 196002631  374 LRIEENARINRQIR-SREDQLRIGANNL-KSELEHDKKKYDNEMKTREDQHYLQNSIELKHLRADTNYKRQQQIKAEEMR 451
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
14_pfamImport 240 GKAQKEAEQFQRVRWRTEEAEErRRQERQRVLAELAEQKIRQARCHEHKTSKDRVQHLQELSVLRERNNHILKLKAEKEE 319
3_pfamImport  226 ERARREELQGRRAKEVAERKER-EHQAHLEALARAGERRLQHAMQAAEEAVQQKARRVGQSRLEKERAQRANKEKVERDE 304
8_pfamImport  225 E-ARREELQSRRAKELAERKDK-EHQQHLEALARVGEMRMQHATQVASEAVQLKARRVGQSRLEKERTQRANKEKVDREK 302
29_pfamImport 226 ERAKREDLQIQRAKLAAERKDR-EQKEHLRALAQASERKLQHAAQVAEEVVQQKARKVVQNRLEKEKMQKVNKRKVEECE 304
27_pfamImport 218 NQMLEREEKFKSMARIQEKLND-EFREWRQQLIEYRAFVNARATVKVNQQLSARLEDMRKERVAKTMHHDRIMQGIQNEE 296
gi 557023125  491 ERAKKEELQIQRARLAAEKKER-EHREHLEALAKLAEKKLQHAAQVAEETAQQKARRAVQSRLEKEKLQRLNKQKVEQDE 569
gi 449504359  448 EKARREDMQIQRAKLAAEKKEK-EQKEHLEALARETERKLQHAAQVAEEAVQEKARKVVLSRLEKEKVQKMNKQKVEQYE 526
gi 512862172  530 ERARKEELQILRAKQAAEKQEQ-GRQEHLQKLAIVAEKRLQHAAQVAEEVVQHKARKAIECRLEKERIQRENRQRVQKNE 608
gi 545507851  556 ERARREELQGRRAKEVAERKER-EHQAHLEALARAGERRLQHAMQAAEEAVQQKARRVGQSRLEKERAQRANKEKVERDE 634
gi 196002631  452 AEIMKMQKQFRKQQETAKLMTE-EHDEWLKHLQLEEDLKLEKAETIAALVKEEKRFRAKEQREARQAGQKLNMKKIKKQE 530
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
14_pfamImport 320 KCHIEGIKEAIKKKEQRVEQMTRWKDPIFQEFQKVPSASKTDR----------CFDYVAAETQLPA 375
3_pfamImport  305 DCRRRELLQAIGRKLERSEQLSRERRSALESARSTARASFHVRekvreetntrSFDRMVRDAQLHA 370
8_pfamImport  303 DSRRRELQQAIERKSERTERLSRERRSALENARSSARASFHVRekvreetktrTFDRMVMEAKLHA 368
29_pfamImport 305 DIRRREILLSIEKKLERSEQICKEKKTVLESAKSVARASFHVRekvreemnmrTFDKMAFEAELQA 370
27_pfamImport 297 SKKMSTLKRKVHFKEMKSEIVARKKDQEINQSRAMAWASAELRdklsktlnpeTFDQKVHRVEMEN 362
gi 557023125  570 NFRRKELLMSIEKKLERSEQIFKEKKTVLENARSIARASFHVRekvreetnvrTFNKMALEAELHA 635
gi 449504359  527 DLRRREILLSIERKLERSEQIFKEKKTVLENARSVARASFHVRekvreetnmrTFDKMAFEAELHA 592
gi 512862172  609 DMKRKELLESIEKKLERSDHIFRERQTVLDNARSVARASFNIRekvraetntrTFDKMAFEAELYA 674
gi 545507851  635 DCRRRELLQAIGRKLERSEQLSRERRSALESARSTARASFHVRekvreetntrSFDRMVRDAQLHA 700
gi 196002631  531 ELKQRYTTAQAMSKDRKRQQIAAAKEENLSKLRDTARATSLMRykvkemtaksSIGILleslgtdq 596
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap