Conserved Protein Domain Family
Imm15

?
pfam15561: Imm15 
Immunity protein 15
A predicted immunity protein with an alpha+beta fold and several conserved polar and hydrophobic residues. Proteins containing this domain are present in heterogeneous poly-immunity loci in polymorphic toxin systems.
Statistics
?
PSSM-Id: 317894
View PSSM: pfam15561
Aligned: 2 rows
Threshold Bit Score: 200.71
Threshold Setting Gi: 644440320
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295112072  20 IIRETGLYNLDYFIEEHEgGYEEMPILDYFPQAKFLKRvIKKEEISALLLDIALFFVNVILLYAYNKLTEKQFANFFIAI 99
gi 644440320  11 LIEKEGLDDLSVFFSDYE-TFEEIPLFSRFKHISFLSS-LSFNEKNKILIKKCIELINKCKLNAKNYIDDKNISDYFICV 88
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 295112072 100 FVVDFdhleEDYGDYGHFNPRILVSREAD--------KYTFVSQEMLFDYKRCekfykhvskvaglgdfmfyrhydDKND 171
gi 644440320  89 SLTDW----ENYEDVNCLTPNIYISRKKNwllshlklKHSQTIEENLIREYLC-----------------------SIKE 141
                        170
                 ....*....|....*....
gi 295112072 172 LDTIYMVPNR-EGYSPVSL 189
gi 644440320 142 LDYIVLISSGfENYKRVYI 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap