Conserved Protein Domain Family
Imm47

?
pfam15573: Imm47 
Immunity protein 47
A predicted immunity protein with an alpha+beta fold and a conserved KxGDxxK motif. Proteins containing this domain are present in heterogeneous poly-immunity loci in polymorphic toxin systems.
Statistics
?
PSSM-Id: 317898
View PSSM: pfam15573
Aligned: 3 rows
Threshold Bit Score: 422.366
Threshold Setting Gi: 228706525
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597828843  19 LMNSIWFGEKTTLDKLEIKEKILNSVTEKEVLFNLIELFKTGDFTQKTLLFQLMNQTRNESVLNLCIRMFLAVATHDDLR 98
gi 501987468   7 ISNNIWFGQPSSSSPSTIKENLLRATTEHEALFHLIELFKLGDFTQKRLLFQLMNYTNDEALLNLCIRVFCSISTHEDLR 86
gi 228706525   7 LKKDIWYGEVSNHTIETLKSNLRDGATEKECFILINELLKLGDFSVKGLLIELMNSTRDELVLNLCTRLFCSVATHDDLL 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597828843  99 DSNNLRFLSEVNEETVNTFASAAITSLSLDIIPYLLALLEEWDEISDTAI--IIRDSIDSFINFEEQIGEEATIDEIGNF 176
gi 501987468  87 DSNHLLFLGEGNKAAVDTFASEAITTLSLEVIPYLMALLEEWDSIRDTSV--MIRDSIDCFINFKEHLGDNATVDEIGEY 164
gi 228706525  87 ETNNLKFLSSASEDGVHNFVVSAGETLSYHVVPYLLALLEEWE---DTFVekAIRNELSWMLGIEDEYYE-VSLEEFNEA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 597828843 177 YFNYCEEMDTESYYFQQNLAFPGDLAKKLIQRVLIAANNEEPLKMELIPSLLSIWSGEKVPADYNTVINANNYKDFIDYI 256
gi 501987468 165 YKDFMEDCDAGQYYYHQNLSFLGDLTKILMQRVFIAANHEQMLRMELIPSLLSTWSGEKVPGDYHTIITSENYKDYVSYV 244
gi 228706525 163 YSGFIENNDAQEYYYRNRLSFPGDLAKELVSEVMSSLRDRTTYNVVTIPSVLSIWSGIKCPIQYDTIITNEKNRELMSYI 242
                        250       260
                 ....*....|....*....|
gi 597828843 257 DRLSSKNWEKGQKYFYGYKL 276
gi 501987468 245 KGLANRKWEKGQKYFYGHLL 264
gi 228706525 243 DVLTKKEWKIGKKYFYGYVV 262
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap