Conserved Protein Domain Family
Imm48

?
pfam15574: Imm48 
Immunity protein 48
A predicted immunity protein with an all alpha-helical fold and a conserved HRG motif. Proteins containing this domain are present in heterogeneous poly-immunity loci in polymorphic toxin systems.
Statistics
?
PSSM-Id: 317899
View PSSM: pfam15574
Aligned: 8 rows
Threshold Bit Score: 164.059
Threshold Setting Gi: 494658048
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 493019993   7 YYSEVKKMIQQFLNTSQLvpEILNE------QEKQIIATFCFGMINGYSLKNKKNAIQIQGATIDILIEMFFYSPAASAE 80
gi 489236914   5 YVSESLRIANDIIQLVKI--DLKDE------MNRQILASYIFGVLNAKAIQESISPIDVQVTMIRVGIKALGYSPEAATQ 76
gi 490970329   4 QVDKTLNMVDKIVNNITV--DLNDE------MQRQILAGYIFGVLNGLAYEESVSALDVKAIMIRIAIEKLNYETKAATE 75
gi 496265461   7 FKKKAKEASNDISRILRIt-EFQDE------LARQVYGAFMFGVLNALAYEMGKSPTDVQGMMIELSIHELGYETNQAVE 79
gi 494810817   5 FFEAARNCACKVAEVIKF--DQKNP------FEAKVVTSYLFGMLTMLGSDMDADGSEIQASLVAALVHNFHFSELEASK 76
gi 494658048  19 HVSESVATMEQYLRGIIA--HYGDArfqgdaQAREVLSVYSFGGITALALQHQMSPPLAHAVCLTLLTKFFGFDQADAAN 96
gi 489008362   5 IVNEAIEMVDKFLSLVTI--DLEDD------LDRQLVAAYIFGMLNGKAHEESIPPTDIQALMIRIGIDKLSYPTETAYQ 76
gi 446314267   7 FLNECMNIINTTIYKVFKi-DINDE------QEKQILGAYLFGMFNGLGHEKNIKPVDIQGAMIQILNEKLNYSLESAVQ 79
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 493019993  81 FCNFLIECTDKSFHPTMHSIIHRGIQGYYQYEEA-KNNELKDNIENVIEVVK 131
gi 489236914  77 MTQFVIDATDKNFHSTVYAIIHRGIEAFYLYSNE-KYEQLKEDFDNIMASIK 127
gi 490970329  76 LVDFLIESTKKEFHPTMNAIIHRGISAYYLYLEE-KYADIRTDFTDIITVIK 126
gi 496265461  80 FCQYVINCTDRENNPTTYAIIHRGMEGYYQLKEK-KEAELITNYEDIIKALK 130
gi 494810817  77 LSSHAIHCTEKAKHPTQFTVIGRGLESYVDYYQKgDYKEIQKDVSSIFDIVR 128
gi 494658048  97 KAEAVITATPDR-TSHLYGIVHRGADGFIHWQQH-SDDGAAKDFAEIMAHFQ 146
gi 489008362  77 MTQFMIDATDREFHPTVNAIIHRGIEGYFLYEDN-QYGVLSDDFQDIVQLVK 127
gi 446314267  80 FSQFLINSTDKNFHPTMFAIIHRGLEGYFMYKDG-RNEELSRDFHDIIEVVK 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap