Conserved Protein Domain Family
DUF4661

?
pfam15576: DUF4661 
Domain of unknown function (DUF4661)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 281 and 302 amino acids in length.
Statistics
?
PSSM-Id: 317901
View PSSM: pfam15576
Aligned: 8 rows
Threshold Bit Score: 336.45
Threshold Setting Gi: 395533874
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71152371   16 RKKSTKADlpaPEPRWvDSSPENSGSDWDSAPETMGDVGPLKTKDSGTRRPPGAAPESSRDL----KVDQLGSKRMdSLK 91
gi 395533874  16 HRKEPLPD---PDSVR-NSSPEKSGSDWDSAPDTVGDPGQPKAGDARRQMNRGNPPEWSKGCpshgDPERLRDRRN-SPN 90
gi 655840152  16 RRKPAKPDstaPEPRWvDSSPENSGSDWDSAPETMGDVGPPKTKDSGTPRRSGAAPEPSREP----RAEQLGSKGMdSLQ 91
gi 512969777  16 RRKPARSDppaPEARWaESSPENSGSDWDSAPETMGDVGPPKTKDSGTLRSSRAAAELRREP----QVEHSGSKRMdSRK 91
gi 562851204  16 RRKPVKPDpraPEPSRvDSSPENSGSDWDSAPETMGDVGPLKTKDSGASQNSGATPEP-RGL----QVEHLGSKTRgSPK 90
gi 344307310  16 RRKPTKPDlsgPELRRmDSSPENSGSDWDSAPETLGDARPPQAKDSGTRKSSETAPEPSRAP----SVAQLGSRRMdSLK 91
gi 586522558  16 RRKP-RPDlptIEPRWvDSSSENSGSDWDSAPETMGDVGPPKTEDSAAQRSSEVAPQPSREP----RAEQLGSKRMdSLK 90
gi 752438597  16 RRKPTKPDlptPELRRvDSSSENSGSDWDSAPETMGDVGPPKTKDLGARRSSGTAPEPSRES----QDEQLGSNRMdSFK 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71152371   92 RDKTASTIQEPARLESGGAIPkldwdpVDSGGVKNLgVSAQGRLGTIGPEALLEKPGRRQKLLRWLRGEPG----APSHY 167
gi 395533874  91 LSIDVPHCEESRSLEARRTIS------VNSKDSKGE-VALKRGTNSSNSEAPMEKIRHDHGLLGWLQGETNrglgAHPQY 163
gi 655840152  92 RNKA-----ESERLEAAGAlgm---dpMDAGGTRR----PEEELSIPGPEAAVENASRHQQLLGWLRGEAG----GPPRY 155
gi 512969777  92 WDTSAAGTQESGRLEAGGAIPtlgrapADAGGTLSPrASLEEGLGAPGPEAPVERPGRRQKLLGWLRGDPG----APPRY 167
gi 562851204  91 GAQAASSPQESGRLEAEEAVPklgwdhVDSGGIRRPgVSPEEGLSTRGPE--VEKPGRRQKLLSWLRGEPG----ASPRY 164
gi 344307310  92 LDKAVTGTEQTGRLEAGGAVAklgqdpLDSCGARRAgVLPEGGLNPRGPEAPVEKPGRRQKLLGWLQGESGggvgAPLPY 171
gi 586522558  91 GDKTGSSTLESGRLEAAGAIPklgwdpVDSGGSRRPgMSPKRGLSPSGPEAPVEKPGRHQKLLGWLQRESGggarAPSQY 170
gi 752438597  92 WDKTVSNTQESGRLETGGNVPkwgrdpVGSSGAR-PgVSPEGVRSPPGPEVPVEKPGRRQKLLGWLRGDPRggagAPMQY 170
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71152371  168 LQDPEEYLQISTNLTLHLLELLATALLALCSRPLRAILDALGLRGPVGLWLHGLLCFLAALHGLHAVLSLLTAHPLHFAC 247
gi 395533874 164 LGGSEEWLQISTNLTLHLLELLASALLGLCSKPLRLVLDALGLRGPLGLWLHGLLSFLVTLHGLHMALTLLTAHPFHFAC 243
gi 655840152 156 LGGPEECLQISTNLTLHLLELLASALLALCSRPLRAALDALGLRGPLGLWLHGLLSFVAALHGLHAVLSLLTAHPLHFAC 235
gi 512969777 168 PGDPEECLQISTNLTLHLLELLASSLLALCSRPLRAALDALGLRGPLGLWLHGLLSFLAALHGLHAVLSLLTAHPLHFAG 247
gi 562851204 165 LGGPEECLQISTNLTLHLLELLASALLALCSRPLRAALDALGLRGPLGLWLHGLLSFLAALHGLHAVLSLLTAHPLHFAC 244
gi 344307310 172 LGDPEERLQISTNLTLHLLELLASALLGLCSRPLRAALDALGLRGPLGLWLHGLLSFLAALHGLHAVLSLLTAHPLHFAC 251
gi 586522558 171 LGGPEECLQISTNLTLHLLELLASALLGLCSRPLRVALDALGLSGPLGLWLHGLLSFLAALHGLHAVLSLLTAHPLHFAC 250
gi 752438597 171 LGGPEECLQISTNLTLHLLELLASALLGLCSRPLRAALDALGLRGPLGLWLHGLLSFLAALHGLHAVLSLLTAHPLHFAC 250
                        250
                 ....*....|....*..
gi 71152371  248 LFGLLQALVLAVSLREP 264
gi 395533874 244 LFGLLQALVLVVSLREG 260
gi 655840152 236 LFGLLQALVLAVSLREP 252
gi 512969777 248 LFGLLQALVLAVSLREP 264
gi 562851204 245 LFGLLQALVLAVSLREh 261
gi 344307310 252 LFGLLQALVLAVSLQEP 268
gi 586522558 251 LFGLLQAMVLAVSLRGP 267
gi 752438597 251 LFGLLQALVLAVSLREP 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap