Conserved Protein Domain Family
Imm8

?
pfam15586: Imm8 
Immunity protein 8
A predicted immunity protein with an alpha+beta fold and a conserved WEa (a: aromatic) motif. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, usually containing a domain of the Ntox7 family.
Statistics
?
PSSM-Id: 317908
View PSSM: pfam15586
Aligned: 17 rows
Threshold Bit Score: 108.922
Threshold Setting Gi: 81535642
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122253352   5 IKAVEITEVaelapekfvPDDPEDFVCTFGLTIGPTGGEGGELFYVTVCTPRRLEKLC-ERDG-------FVWGRHHLIV 76
gi 81535642    8 ISSVDWDGD---------TELPVGSCVWLHLEIGVAGRPGADLFQIGVCDPAWRDLNVrDQSQefsvgdvHFAGEAILLL 78
gi 75355370    5 LKNYDCSDFdle---dfpQDKLENFCILLTLSIGFDESNGADYFYVYIYSTEWLLSNI---HR-------PMSLKNSIVT 71
gi 75355372    6 LKSINLYDIdfe---kftPEIPDNFHRWIDLDIGIEGEQGSSIFSLCICSPKWISHHC--NKE-------GFFWSNALIL 73
gi 81785052   37 LKAINLYDCafe---dfvPEIKDNFCVGIDLDIGTDDSDAADIFSVRICSPKWILHNCfQNQR-------VKWGAGMMIM 106
gi 501191814   5 IRSAGVWGHpnlr--twaPDDPDAFAELVMLDIGPRKGAGADSFTLRVATPAGLDRLE-ARDG-------ILATRPLLVM 74
gi 503050078   5 VRQVR---Fpdle--tgqPFDRVNTVQLAEVYVGVVGEPGEEHYQVTACTPAALVDLL-AKQS-------FLLGRHWLFV 71
gi 763120448   5 IRGYSVTENedls--tyePEAQQVFGFTLLFEIGIQGQEGSDFFEVEVASPAFLERLA---SH-------PLFLRHTILA 72
gi 500938476   6 LYSACVGGFinlr--kwqPENEEVVSELINLEIGIKNKKGSDGFTFNLVTPQGFQLLLrEKGI-------IATRRPLLIV 76
gi 500747641   1 mKSLRSDQIpdls--ryvPPEPESFAIPLVLEVGPLGLRGRERFDLLAVTPRWLQERH-GKGG-------AILGRGLLVV 70
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 122253352  77 PFYDFGRICSIIRRFVNNASG-LDWTEIGPKLARLGAWEFEDY 118
gi 81535642   79 DAIEMVRIKQAVNSILNRFGAfDDWRDFGNSMKRFAVWEFDLY 121
gi 75355370   72 NRFNIEHILKLINDILEICNS-TSEDKSISNLAKYFDWEFDDY 113
gi 75355372   74 EQFDHKIIKSEIDKILEYCSK-ETWDLTLSNLLRFFSWEFEDY 115
gi 81785052  107 NEFNHSVIKSEIEKILKECSK-ETWEKSLTYLLRFFSWEFEDY 148
gi 501191814  75 RRYDFDDLWRWLEQTVASCEA-ETWPACVENLRRYFAWEYESY 116
gi 503050078  72 AEFSPATVEAALRKLIGNIEA-SSRVELAQKVGRIGLWEFEDY 113
gi 763120448  73 TDYNIPAAVALVRKYVEKLEE-DSWEKLASKISRVLRWEFEDY 114
gi 500938476  77 ERYDFGQIWNSLEEIIASCQD-DSWSLCVEKLKKYFDWEYDNY 118
gi 500747641  71 FEWRYERVRAFLARKVEACSG-ATWLDVVRKVGQIAEWEGgee 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap