Conserved Protein Domain Family
CENP_C_N

?
pfam15622: CENP_C_N 
Kinetochore assembly subunit CENP-C N-terminal
CENP-C is a vertebrate family that forms a core component of the centromeric chromatin. On depletion of CENP-C proper formation of both centromeres and kinetochores is prevented. The N-terminal of CENP-C is necessary for recruitment of some but not all components of the Mis12 complex of the kinetochore.
Statistics
?
PSSM-Id: 317934
View PSSM: pfam15622
Aligned: 13 rows
Threshold Bit Score: 350.71
Threshold Setting Gi: 1023018227
Created: 5-Apr-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434446    7 DHLKNgYRRRFCRPSRARDINTEQGQNVLEILQDCFEEKslandfstNSTKSVPNSTR-KIKDTCIQSPSKE--CQKSHP 83
gi 51871605     7 DHLKN-YHRRFCRPSRAPNIPTKQGQNMLEILQDCFEEQ--------NSTESLSCSTP-KEKDIYVQSTGKE--RQASHS 74
gi 586984696    7 DHLKNdYRRRFCRPSRAPDINTKQGQNILEILQDCFEEKsltndfstNSTKSVLYSTP-KMEDICIQSSSKEaqCQKSHP 85
gi 859842384    7 DHLKNdYRRRFCRPCRAPDIKTKQGQNILEILQDCFEENslandfstNSTKSLLYSTP-KTGDICIQSPSKEaeCQKSHL 85
gi 664761877   35 DHLKNdYRRRFCRPSRAPDINMQVGQNILEILQDCFEEEspandfsgNSTKSVVYLTP-KTKDLCVKSPSKEaqCQKSHP 113
gi 350587612    7 DHLKNgYRRRFCRPSRAPDINTEPNQNILEILLDCFEEKslpsdfstNSTKSGLNSTP-KIKDNYIQSPREEiqCQKA-P 84
gi 86821655     7 DHLKNdYRRRFCRPSRVPDINTEQGQNILEVLIDCFEEKslandfskNATKSVLYSTP-KTKDICIQSSSKEtqSQKSHP 85
gi 731499028    7 nhlkndyrrrycrpsRAPDINVEQGKNILEILQDCFEEKslandfstDSTKSVPCSTP-KIKDTCIQSPSKEh--QKSRP 83
gi 884873537    7 DHLKNdYRRRFCRPSrAPGINTEQSQNMLEILQNCFEEKslt--dvtNSPESVLYSTL-KIKNSFIQSPSKD--CQISFP 81
gi 1023018227  13 DHLKIsYRTRFCCTSRLPVTDLWQGQNLLENIQDCFEEKsydtgfstNPGSPTLCSTPcKLRNDSYSSPNKE--CQISPS 90
gi 532092172    7 DHLKNgYRRRFCRPFRVPDINTGQGKNMLEILQDCFEEKsltndfsiNSTKSVRYSTP-RVKDNSIHSSSKE----KSHS 81
gi 655857975    7 DHLKNdYRRRFCRPSRARNINKEQGQNMLEFLQDCFEERslandfstNSTKSVLCSTP-KVKDSCFQSPGKE--IQKSCP 83
gi 989973583   11 DHLKNgYRRRFCRSSRPPDINMGQGQNILVILQDCFEEKslandfstNSTKSVLYSTP-KIKDTCLPSPSREaqCQKSHP 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434446   84 ----KSVPVSSKKKEASLQFVVEPS----EATNRSVQAHEVHQKILATD-VSSKNTPDSKKISS--RNINDHHSEADEeF 152
gi 51871605    75 ----ESVPISSRRKEASLQVPAKPS----DPADEPVQANEVHQKILSTD-VVSKSTPDSTKTSS--KGVKGHHGASDE-L 142
gi 586984696   86 ----KSVPVSSRKKEASRQFTVEPR----EVVNRSVQDHEVHQQILATD-VGSKNTPDSRKMSS--EKLKRHHGGVDEeF 154
gi 859842384   86 ----NSVPVSLRKKEASV-----PS----EVDSRSGQDHEVHQQILTAG-IGSKSTPGSRKMSS--KKLKDCHSEADKeL 149
gi 664761877  114 ----KSIPVSSRKKEASLQFLVEPS----EAANRSVQAHEVHQEILATD-VGAKNTPDSRKMSS--KKVKDHHNEVSEeF 182
gi 350587612   85 ----ESDPVSSKKKQASMQLIVEPG----EAVNTSVQAHEVHHKILAPE-VHSEHTSDLRKMSG--KKLKDHHKEADEeF 153
gi 86821655    86 ----KSGPVSSRKKEVPLQLTVEPN----EAVSKSVQDHEVHQKILATD-VHSKNTSDLRKMSS--KKLKDNHNEADEeC 154
gi 731499028   84 ----KLLPASSRKKEG---FIVEPN----EEISKSVQAPEVHQKTPATD-VGSENTTDLKNVSS--RKQNDHHNEVDEeF 149
gi 884873537   82 vssrKSLPFSSRKK-ASLQGVIEPS----EAASRSVQVHEINQKVPEAD-VGSKSTPDLGKKSD--KKTNGLCAETDEeF 153
gi 1023018227  91 ----KTDCVSSVKKKAKTSVLSHQTimlqSQGNNSVLPPEIPQKLSQADlVDLKNTPNLKYASSgaEEFNKIPNEVVEeF 166
gi 532092172   82 ----KSVPVSSRKKEAPLQDIIEPN----ETAHKSVQGHEVLQKILATD-IVSRNTPDLKKKSS--KKPSDHPSEAEEeF 150
gi 655857975   84 ----KSVPVSSKKKEDFLPCFEEPS----KTSNRSVQAYEVHQKSLATD-VGSRNTPDSKKISS--RKLDDYESESDEeF 152
gi 989973583   90 ----KSVPVSSRKKETSLQLTVEPN----EAVSKSVHTHEVHQKTLATD-VGSKNTPDSRKMSN--KKLKDHHNEADEeF 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296434446  153 YLSVGSPSVLLDAKTS----VSQNVIPSSAQKRetYTFENSVNMLPSSTEVSVKTKKRLNFDDKVMLKKI--------EI 220
gi 51871605   143 YLPGGSPVVLLGARVS----GSQKAISSGGQKR--VTSRRSADMQSSNTDISFKTRKRLNFEDKVISNTA--------EI 208
gi 586984696  155 YLSVGSPFVLLDAKTC----VSQSAVSSIAQNRktYTSEKSVNTLSSSTEISLKTRKRLNFEDKNISKKV--------EI 222
gi 859842384  150 HLPVGSPFVLLDAKAS----VSQNVISSIAQKK------NSVNTLSSSMEISLKTRKRLNFEDKIALKEV--------EI 211
gi 664761877  183 YMSVGSASVLSDAKTS----VSKNAVASVVEKRetHSLKNSISMLSSGTESSHKTKKRLNFDD--VLKKV--------AI 248
gi 350587612  154 YLSIGSPS-DLDAKAT----LLQKAVPSVAQKRetYTSENSVNTMSSSTESSRKTKKRLNFGDKDVLKKV--------EI 220
gi 86821655   155 YLSIGSPS-DLDIKAS----SLQKGSPSVAQKRetYTSENSVNMLSSSTQISHKTRKRLSFEDKDVSKKV--------EI 221
gi 731499028  150 YISVGSSSVVLDAKAS----LSQNAIPSIAQKKetYTSENSLNVLSSSTEISCKTKKRLNFED--ISKKV---------- 213
gi 884873537  154 YISVGSPSVLLHGKPS----ESQNAISS-AQKRetHT---SGNILSSGTEISLKIRKRLNFEDKDTFRKV--------ER 217
gi 1023018227 167 YLTVGSPGLL--AKETeilpLPKQATPT-AHDRwnHKFGNSVNQQPSLPTSSLKTKKSLNYEDITVWSAV---------- 233
gi 532092172  151 YLSVGSPAVLLDAKTS----VSQNTSSSLAQKRetYTFGNSLNMLSSSTEISLKTKKRLNFEDKDIFKKV--------EI 218
gi 655857975  153 YLSVGSPSVVLSAKTS----TSQNAIPSVAQKRetYIFENSENMLSSSTEISLKTKKRLNFEDKDILKNI--------EI 220
gi 989973583  159 YLSVGSPSVLLDPKTS----VSQNAISSIAQKRetYTFENSVNMLSSSTEISLKTKKRLNFEDKDISKKVdkdiskkaEI 234
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 296434446  221 DNKVSDEEDKTSEG-QERKPSGSSQNRiRDSEYEIQRQAKKSFSTLFLETVKRKSESSPIVRHAATAPPHSCP 292
gi 51871605   209 ESSASQVEDSISEE-QEGTSSETSQKR-DDLSSEIQPQSKKSFSELYLETVNRKSKCSSVVRHTAAVPSPPYP 279
gi 586984696  223 PNELSETEDKVSEEpQERKSSRTSQKRvQDSEYEVQPQTKKSFSALFLETVKRKSESSPVVRHIATAPPHSSP 295
gi 859842384  212 ANKIPEIEDKGSEEpQERKLSRASQKRvPDLEDEIHPQTKKSFSTLFLETVKRKSESSPVVRHIATAPLHSSP 284
gi 664761877  249 ESKVSEIEDKVSEGpQEKKPSGASQKRiQDSEYEIQPEAKKSFSTLFLETVKGKSESSPIVRHIATTPPHSSv 321
gi 350587612  221 VNNTSEIGDKVSEGpQEKKQSGTSEKRiQGSEYEDQPQTRKSFSTLFLETVKRKNESSSVVRHT-TAPPHLSP 292
gi 86821655   222 MNEVSEIEDKVSEGlQERKQSGTSQKRiQDSEYENQPQARKSFSTLFLETVKRKSESSSVVRHIATVPPHLSs 294
gi 731499028  214 -----EIEDKVLEGpQGKKASGTPQKRtQDSEYEIQPKAKKSFSILFLETVKRKTESSPVIRHVATDPPHSSP 281
gi 884873537  218 ETDKSKVENKIL-GqEEKKVSETSSKRlQDTEYEIKSQAKKSFSTLFLETIKRNNESSSVVRHTSTAPSHSSP 289
gi 1023018227 234 --KTAEKDIKLSERrQKRIQSE-SEKGsQDTKQKIQQRAKTNFSTLLLEAAKGNCRNSSVHRHV-------SP 296
gi 532092172  219 ENKVSEVENKIPEGqQERKPSETFQKSvQDLEHEIQPQTKKSFSTLFLETVRRKSEFSPIVKHIVTAPPHSSs 291
gi 655857975  221 ENEVSEVEDKISER-QERKQSETSQKRiQSLELEIQPQATKRFSTLFLETVTRKSESSPIVRHTATASPHLSP 292
gi 989973583  235 ENKVSDIQDEVSGRpQERKLAEASQKRiQGSEYEIQSQAKKSFSTLFLETLKRKSESSPVVRHIATAPLHSSP 307
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap