Conserved Protein Domain Family
Tox-MPTase4

?
pfam15640: Tox-MPTase4 
Metallopeptidase toxin 4
A zincin-like metallopeptidase domain found in bacterial polymorphic toxin systems.
Statistics
?
PSSM-Id: 317947
View PSSM: pfam15640
Aligned: 6 rows
Threshold Bit Score: 216.172
Threshold Setting Gi: 500527887
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 493726430 325 EGKPVSGQR-KMTPGGQRYASVRDWKTLKKTMQARGINVSIDSKGKILidpltGERKAGGFNPYTGEIILKPDATLHEMI 403
gi 375079904 254 EEMPVSGQR-RLTSTGHRIMDISEMKSFKKEMGAIDIKVLIDKKDKIL-----PENAAAGFNPATGEIVLRKEPTNLSAI 327
gi 503686707 197 EEMPVSGQT-RIAPNGQRLMSISELKNFRREMASNNIKVVIDKKDNIL-----PSSAAAGFDPDTGEIVLRREPTYLSAL 270
gi 915345988 144 EDMPVGGQA-RLTADGLRIMSIRDLKKFKKDMNEIGIKIILDKKEKIL-----PRNVARGFDPYTEQMVLRTDASLLSAL 217
gi 493019862 407 DTKRVSGNVfKFDKNGNRIMRVADFKAYREGLSKQGIEVVIDKK--IV-----PRGKAGGFDPETGKIYFRGRPSQIAAY 479
gi 500527887 175 DFRKVNIQT---NEIGETLATRKEIRAYKKEWGELGIKVNIDKKGTIL-----PNNVEAAFDFVNGDIYLKKKPSVINMH 246
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 493726430 404 HETIHAEQWFKLGKENYLKQTVLEREEHVFNELMKPSYNLNEEEIFHAKKVIFKYRNG 461
gi 375079904 328 HESYHAKQWKELGKDNYLQQSTLEREEFVYNEIMKNKVLFNDGEILFSQKYIYKLRNG 385
gi 503686707 271 HESYHANQWSKLGKDDYMKQSALEREEYVYNEIIRNKDKFSEAEILFSQRYIYKLRSG 328
gi 915345988 218 HESYHAKQFRELGQENYLKQSRSEREEYVYNEIMKNKEKFIAEEIYEAQRYIFFIRNK 275
gi 493019862 480 HENVHAQQWLELGKENYLKQTVLQREEHVYNKIMENRANFTRAEIIATERYIYSLRNG 537
gi 500527887 247 HEGFHAEQWLDIGKEQYMNLSRLEREEYVFEQVMKNKHLFDKASIDHSIEYIERLRLK 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap