Conserved Protein Domain Family
Imm75

?
pfam15660: Imm75 
Putative Immunity protein 75
This family is highly conserved suggesting it might derive from a phage protein. Members are less than 90 residues in length, and the function is not known.
Statistics
?
PSSM-Id: 317963
View PSSM: pfam15660
Aligned: 3 rows
Threshold Bit Score: 139.031
Threshold Setting Gi: 490668395
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 469641244  18 VRALVALKRELLPGVTTFIDSVRLEAIDDKADRLMVTTSVGEEARLVYFNPDFAGTPTFGRRLYRLRDWTDDLADWVDRL 97
gi 760205726  18 VRALVALKRELLPGVTTFIDSVRLEAIDDEADRLMVTTSVGEEARLVYFNPDFAGTPTFGRRLYRLRDWTDDLADWVDRL 97
gi 490668395   4 VRALVALKRELLPGVTTFIDSVRLEAIDDKADRLMVTTSVGEEARLVYFNPDFAGTPTFGRRLYRLRDWTDDLADWVDRL 83

                 ....
gi 469641244  98 RRER 101
gi 760205726  98 RRER 101
gi 490668395  84 RRER 87
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap