Conserved Protein Domain Family
TMEM252

?
pfam15664: TMEM252 
Transmembrane protein 252 family
This family of proteins is found in eukaryotes. Proteins in this family are typically between 152 and 182 amino acids in length. The function is not known.
Statistics
?
PSSM-Id: 317967
View PSSM: pfam15664
Aligned: 13 rows
Threshold Bit Score: 191.129
Threshold Setting Gi: 1033392220
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 68565213    29 SWgSIFDCQ-GSLIAAYLLLPLGFVILLSGIFWSNYRQVTESKGVLRHMLRQHLAHGALPVATVDRPDFYPPAYEESLEV 107
gi 68565194    29 SN-SIFHSQ-RNLVVAYVLLPMGFVILLSGIFWGTYRQANENKEMFNHVLRQHLAFQDLPLATVDRPDFYPPAYEESLDV 106
gi 126334841   29 SLgSGPNCR-GKLILAYCLLPLGFLILLSGIFWSTYQQASQGKDIFTRVLRQNPRHGAPRVPTVDRPDFYPPSYEDSIDP 107
gi 532076719   29 SSdSIFQCP-RNLIMAYSLLPLGFVILLVGIFWSTYRQASGNKGVFSHVLRRQLAHQDLPLATVDRPDFYPPAYEESLDA 107
gi 354503086   29 SN-SIFHSQ-RNLVIAYVLLPMGFVILLSGIFWATYRQANENKEMFNHVLRQHLASQDLLLTTIDRPNFYPPAYEESLDA 106
gi 512951655   29 SSdSIFHCQ-KNLVLAYLLLPLGFVMLLSGIFWSTYQQASKSKGVFSHVLRQYLAHRDLPLATVDRPDFYPPAYEESVDA 107
gi 426220362   29 SSaSLFNCQ-GNLTLAYLLLPLGFVILLSGIFWSTYHQASESKGVFNRVLRQYGAQGALPLATVDRPGFYPPAYEESLAA 107
gi 311245863   29 STgSMFSCQ-GNLILAYVLLPLGFVILLSGIFWSTYRQASESKGVFGRVLRQHRAQGAVPLATVDRPDFYPPAYEERLDA 107
gi 545486640   49 SSgSIFNCR-GNLILAYMLLPLGFVILLSGIFWSTYRQASKSKGVFTHVLRRHLSHGALPLATVDRPDFYPPAYEESLDA 127
gi 1033392220  62 istgapaCKcNNMPIAYFLLPLGFFLLICGIFWSTYHEASKHKSLFHSILPRHPRIRESYIDTVDRPDFYPPSYEDSTDP 141
gi 562847339   29 SSgSTFNCR-GNLVMAYLLLPLGFVILLSGIFWSTYRQASEGKRVFSHVLRQHLVQGTLPVVTVDRPDFYPPAYEESLDA 107
gi 344297657   29 SSgSSFNCR-GNLIMAYLLLPLGFVILLSGIFWSIYRQARKS----TRMLRQHLAQGHLALATVDRPDFYPPAYEESLDA 103
gi 584036125   29 SSgSTFNCR-WNLILAYLLLPLGFVILLSGIFWSTYRQASENKGMFSHGLRPHLAHRAMAPATVDRPDFYPPAYEESLDA 107
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 68565213   108 EKQSCP-------AEREASGIPPPLYTETGLEFQDGNDSHPEAPPSYRESIAGLVVTAIS-EDAQRRG 167
gi 68565194   107 EKQACP-------AGRELLGFPPPLYTETNLEFEHLEDPQPEAPPPYQEIIADAGAPAKA-QDAEEPS 166
gi 126334841  108 EKQLSL-------EQKEAFNIPPPLYTESSLEFMDNTDSHREIPPSYEVSVRGMLMA----EGAAVVA 164
gi 532076719  108 EKHTCP-------ADPEALDIPPPLYTETGFELQGENGAHPEAPPSYQASVADLVSAATS-EDAERPS 167
gi 354503086  107 EKQTCP-------AGGGFLEFPPPPYTATSLELEDENEPQPEAPPSYQESTAGTVVTVKA-QDAVGPS 166
gi 512951655  108 EKQALA-------EEVKALDAPPPLYTETGLELKDENKAHPEAPPSYQESMADLVAAVTS-EDTARPS 167
gi 426220362  108 DKQACH-------TEQEISGAPPPLYTEMGLEFQDEDGAHPEDPPPYDESAADGVAAARPwQDAQRQS 168
gi 311245863  108 EKQACP-------AEPEALCVPPPPYSETGLIYEDEDDAHPEAPPSYNESVADSVVEAIP---SQRQS 165
gi 545486640  128 EKQPCP-------TEGEVSDIPPPLYTEPGLEFEDAADAHPEAPPSYEESVAGGVPAATPlQDAERQS 188
gi 1033392220 142 EKQTYPlpvnpleREKEAYNIPPPLYTESSLEFIEEVSAQDEQPPSYEASLRHQVAE----PDSVQEE 205
gi 562847339  108 EKQTGV-------AEGEVSDGPPPVYTETGLDFEEENDGHPEAPPSYEESVADLESAATS-EGAERQs 167
gi 344297657  104 DKQTCG-------AGGAASEIPSPLYTEVDLDVSGEIEAQPEAPPPYEESVTDIEAAAMS-LGAEGHS 163
gi 584036125  108 GKQTCP-------AEGEAVDIPPPLYTEMDLGFEVESGAHQEAPPSYAESVVDGVAAATPwKDAQRQS 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap